KEGG   Pseudoxanthomonas spadix: DSC_10475Help
Entry
DSC_10475         CDS       T01643                                 

Definition
putative CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DSC_10475
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DSC_10475
Enzymes [BR:psd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DSC_10475
Two-component system [BR:psd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DSC_10475
Bacterial motility proteins [BR:psd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DSC_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2065099..2065677
Genome map
AA seq 192 aa AA seqDB search
MPAPSSRFDAIVIGASAGGVLALQQLLACLSAQLPVPVLIVLHLPRDRTSRIAELLATHC
RLPVSEAQDKQPLQPGTVVFAPPDYHLLVEDRNTLALSVDAPVLFSRPAIDPLFESAAEV
FGTRLLAILLTGASSDGTAGIAAVRAAGGTAWIQSPQEASSPLMPASALAHAGADAVLTL
QDLCTHLRQLYP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgcccagctcgcgcttcgacgccatcgtcatcggcgcatcggctggcggcgtg
ctggcgctgcagcagctgctggcttgcctgtccgcgcagctgccggtgccggtgctgatc
gtgttgcacctgccacgcgaccgcaccagccgcatcgccgaactgctcgccacccattgc
cgcctgccggtcagcgaggcgcaggacaagcagccgctacagcccggcacggtggtgttt
gcgccgccggactaccacctgctggtggaagatcgcaacacgctggcgctgtcggtggat
gcgccggtgctgttctcgcgcccggcgatcgatccgctgttcgaatcggccgccgaggtg
ttcggcacgcgattgctggcgatcctgctgaccggcgccagcagcgatggcacggccggc
atcgccgcggtgcgcgcggccggcggcaccgcctggatccagtcgccgcaggaagccagc
tcgccgctgatgcccgcttcggccctggcccacgccggcgccgatgccgtgctgaccctg
caagatctttgcacccatttgaggcagctttatccatga

DBGET integrated database retrieval system