KEGG   Pseudoxanthomonas spadix: DSC_14230Help
Entry
DSC_14230         CDS       T01643                                 

Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:psd00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:psd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2900501..2902645
Genome map
AA seq 714 aa AA seqDB search
MHSPARRRFLSTIAVAAAAGVLPLRPAGAASGSVPVSRAHFPQSVASGDPRPDRVLLWTR
LAAPAAQLRLQVAEDTGFARLRVDRMLQPPRDSDGCLKVRVENLQPATAYHYRFLLDDGH
GGQVSSPIGRTRTAPAADTDAPVELAFVSCQDYGGRWYNTLLPLLERELDLVLHLGDFIY
ETTGDPQFQDQAGERTIALDDIDGAIALERGGQRYYAARSLANYRQLHRTFRSDPVLQAL
LERTPLVAIWDDHEFSDDCWQDVGTYHDGAADERDRQRRRNAEQAYFEYLPVDLELADAT
GAGQAAQLPVQRERLFPNVQLWRRLRFGKALDLLLTDYRSQRPDHAIPEDAFPGALAYDQ
PQLQALLPRLGLEPAAVLPTLIPYVDLAAPMLQAQRRAAQHAIAQAYLAAGQSPAQAERR
ATQATASAIALPVLAQFLQAWNAAAPASAQVAVPDAAGLARGLPWLALGKTTLFGEIGAR
YVAVKEGFDLFAALGALDGAPSPYAPAQRQWLEQALLDSDARFKVVASSVSFTSLVLDLS
RPELQAPEPMRRRFYLNLDQWDGFPAERRRLIGQVFDRAGGVIVLSGDIHAGFATQHSAA
TVEFTTPAVSSETLGSILARSGEGEGAQQQATARVAAALDALVIDGNPSLRYAQTRRHGV
GLLRLDGEHAQARFLELPDSVCRQRHYDAPEAIGSQLGEKRFAFARGDMRLREA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgcccgcacgtcgccgcttcctgtcgaccatcgccgtggccgccgcagccggg
gtcctgcccttgcgcccggccggcgccgcctccggctcggtgccggtctcgcgcgcgcac
ttcccgcagtcggtggcttccggcgacccgcgcccggaccgggtgctgctgtggacgcgg
ctggccgctccggccgcgcagctgcgcctgcaagtggccgaggacacaggcttcgcgcgc
ctgcgtgtggaccgcatgctgcaaccgccgcgcgacagcgacggctgcctcaaggtgcgc
gtggagaacctgcaaccggccaccgcctaccactaccgcttcctgctcgacgacggccac
ggcggccaggtctcctcgcccatcggccgcacccgcaccgcgccggcggcggacaccgac
gcgccggtggaactggccttcgtcagctgccaggactacggcgggcgctggtacaacacg
ctgctgccgctgctggaacgcgagctggacctggtgctgcacctgggagacttcatctac
gagaccaccggcgacccgcagttccaggaccaggccggcgagcgcaccatcgccttggac
gacatcgacggcgccatcgccctggagcgcggcggccagcgctattacgctgcgcgcagc
ctggccaactatcgccagctgcatcgcactttccgcagcgatccggtgctgcaggcgctg
ctggagcgcacacccctggtggcgatctgggacgaccacgagttctccgatgactgctgg
caggacgtgggcacctatcacgacggcgccgccgacgagcgcgaccgccagcgccgccgc
aacgccgagcaggcctatttcgaatacctgccggtcgacctggagctggccgacgccacc
ggcgccgggcaggccgcgcagctgccggtgcagcgcgagcggctgttccccaacgtgcag
ctgtggcggcggttgcgcttcggcaaggcgctggacctgctgctgaccgactaccgcagc
caacgcccggaccacgccatccccgaggacgccttccccggtgcactggcttacgaccag
ccgcaactgcaagcgctgctgccgcgcctaggcctggagccggcggcggtgctgcccacg
ctgatcccctatgtcgacctcgccgcccccatgttgcaggcgcaacgccgggccgcgcag
cacgccatcgcccaggcgtatctggccgccgggcaatcaccggcccaagccgaacgccgc
gccacgcaggccaccgccagtgcgatcgcactgccggtactggcgcagttcctgcaggcc
tggaacgccgcggccccggccagcgcgcaggtcgcggtgccggatgcggccgggctggcg
cgcggcctgccgtggctggcgctgggcaagaccacgctgttcggcgagatcggcgcgcgc
tatgtcgcggtcaaggagggtttcgacctgttcgccgcgctgggtgcgctcgacggggcg
ccctcgccgtacgcgccggcgcagcggcaatggctggagcaggcgttgctggacagcgat
gcgcgcttcaaggtggtcgccagctcggtgtccttcacctcgctggtgctggacctgtcg
cgtcccgagttgcaggcgccggaaccgatgcggcggcgcttctacctcaacctggaccag
tgggacggcttcccggccgaacgccgccgcctgatcggccaggtgttcgaccgcgccggc
ggggtcatcgtgctctccggcgacatccacgcaggcttcgccacccagcacagtgcggcc
acggtggaattcaccacgcccgccgtttcctccgagaccctcggcagcatcctggcccgc
agcggcgagggtgaaggcgcccagcagcaggccaccgcccgcgtcgccgcagcgctggat
gcactggtcatcgacggcaacccgtcgctgcgctatgcgcagacccgccgccacggcgtg
ggcctgctgcggctggacggcgaacatgcgcaggcccgcttcctggaactgcccgacagt
gtctgccgccagcgccactacgacgcgccggaggcgatcggctcgcagctgggagaaaaa
cgcttcgccttcgcgcgcggcgacatgcgcctgcgcgaggcctga

DBGET integrated database retrieval system