KEGG   Pseudoxanthomonas spadix: DSC_14445Help
Entry
DSC_14445         CDS       T01643                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DSC_14445
Enzymes [BR:psd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DSC_14445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2945458..2947380)
Genome map
AA seq 640 aa AA seqDB search
MSSPALNALADAAGLLVDWVDMSGRPQTVAPATLGAVLEAMGLPCASDAQCRQSQDRLAW
LHRAPAMITATIGEPLAVNATPGLRYQLLDETGRACEGTFDAQGRAAGVSAPGYYQLLQA
GAGEQVLQVAVAPARCWSVGDACDDPAARAWGVGLQVYSAPSRHDASIGDADGVLDWVRR
VAAAGGDALALSPVHAARPVGRHYSPYSPSDRRYFDPLHAAPVQVLGQAAADAALQAAGL
AQRFAQLHAAALVDWPGGAQAKWAWLRRLHQDLRDDAHRSDLDAFVREGGDALAAYAAFA
ARDAGDDDVAFQLFAQWLAARSWSNVQQCARDGGMRIGLISDLAVGFDPHGAEAAAWPDA
VLPGLVLGAPPDAFNADGQAWGISSYSPTALKATGFAPFIGLLRAVMHGRGGVRIDHILG
LLRLWVLPAGGSAGDGVYLRYPFDDLLRLLALESWRNRCIVIGEDLGVVPDGLRERLAAR
GVLGIDVLMFTRDADGAFLPPARWRTSAVATTTTHDLPTLAGWKCGRDLDWRQRLGTGGQ
IDRQAEDARRAEDVARLAAQVQADGGDGAQLQDWLAFVAHSPAPLALLPAEDALGLEEQP
NLPGVVEGHPNWRRRLPAAAPGLESTLAGFAQARQRRTPA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgcctgcgctcaatgcgctggccgatgcggcgggcctgctggtggactgggtc
gacatgtccggccgccctcagaccgtggcgcctgccacgctgggcgcagtgctcgaggcg
atggggttgccctgcgccagcgatgcccagtgtcgccagagccaggaccggctcgcctgg
ctgcatcgggcgccggcgatgatcaccgccacgatcggcgagccgctggcggtcaacgcc
acgccaggcctgcggtaccagctgctggatgaaaccggccgcgcgtgtgagggcacgttc
gatgcccagggccgcgccgcaggtgtgtcggcgccgggttattaccagttgctgcaggct
ggcgcgggcgagcaggtgctgcaggtggcggtcgcgcctgcgcgctgctggtcggtgggc
gatgcgtgcgacgatccggccgcgcgtgcctggggcgtgggcctgcaggtgtattcggcg
ccgagccggcacgatgcatccatcggcgatgccgacggcgtgctggactgggtgcggcgg
gtggccgccgccggtggtgatgcgctggcgctgagcccggtgcacgcggcgcggccggtg
gggcgccattacagcccgtattcgcccagcgaccggcgctatttcgacccgctgcatgcc
gcgcccgtgcaggtgctgggccaggccgcggccgatgccgcattgcaggcggccggactg
gcgcagcgcttcgcccagctgcatgccgcggcgctggtcgactggcccggcggcgcgcag
gcaaagtgggcctggctgcgcagactgcatcaggacctgcgcgacgatgcgcatcggagc
gacctggacgccttcgtgcgcgaaggcggcgacgcgctggcggcctatgcagcctttgcc
gcgcgcgatgcaggcgatgacgatgtggcattccagctgttcgcccagtggctggccgcg
cgcagctggtcgaacgtgcagcagtgtgcgcgtgacggtggcatgcggatcggcctgatc
agcgacctggcggtgggcttcgatccacacggtgccgaagcggccgcctggcccgatgcg
gtgctgcccggactggtgctgggtgcgcccccggatgccttcaatgccgacggccaggcc
tggggcatcagcagctattctccgaccgccttgaaggcgactgggtttgcgccgttcatc
gggctactgcgcgcggtgatgcacggccgcggcggggtgcgcatcgaccatatcctgggc
ctgctgcggctgtgggtgctgcccgctggcggcagcgccggtgacggggtgtacctgcgt
tatcccttcgacgacctgctgcggctgctggcgctggagtcctggcgcaaccgctgcatc
gtgatcggggaggacctgggcgtggtgcccgacggcctgcgcgaacggctcgccgcgcgc
ggggtgctgggcatcgatgtgctgatgttcacccgcgatgccgatggggcgttcctgcca
ccggcgcgctggcgcacctcggccgtggccaccaccaccacccacgacctgccgacgctg
gccgggtggaaatgcggccgcgacctggactggcgccagcgcctgggcacgggcgggcag
atcgatcgccaggctgaagatgcacgacgtgccgaggatgttgcgcgcctggccgcgcag
gtacaggcagacggcggcgacggcgcgcagctgcaggactggctggccttcgtcgcgcac
agtcctgcgccgctggccctgctgccggccgaggacgcactggggctggaggaacaaccc
aacctgccgggcgtggtggagggccatcccaactggcgtcggcgcctgcctgcggccgcg
cccggcttggagtccaccctggccgggttcgcccaggcccgtcaacggcgcaccccggca
tga

DBGET integrated database retrieval system