KEGG   Pseudoxanthomonas spadix: DSC_14455Help
Entry
DSC_14455         CDS       T01643                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2949143..2951365)
Genome map
AA seq 740 aa AA seqDB search
MSQATGAQETNDQYETVPADPMLEALVHGHGGDPFALLGPHATEQGTVRVRAMAQGAEAM
ALLNAEGRVVALMRCLDPAGLFEAELGAAMPYRLRIAWPGAIQEMQDPYAFGPVLEDAWL
QGILSGDGEAARLALGAHRMTHEGVDGVRFAVWAPNARRVSLVGDFNSWDGRRNPMRLRH
NGGVWELFVPGIGAGMRYKFEITAFDGQRLPHKADPMARQCELPPATASVVPQAEQFAWT
DAQWMARRSARASTPEPISIYELHAGSWRRTASGGLMDWHQLAAELIPYVRWLGFTHIEL
MPITEYPFGGSWGYQPLGMYAPTARHGTPEGFARFVDACHEAGIGVILDWVSAHFPNDEH
GLQRFDGTALYEHADPKEGFHRDWNTLIYNYGRHEVSAYLVGSALEWIERYHIDGLRVDA
VASMLYRDYSRSEGEWVPNQHGGRENLEAVAFLKRLNSEVGHRFPGVMMIAEESTAWGGV
TLPPEHGGLGFTHKWNMGWMHDTLEYMKRDPVHRRYHHSEMTFGMLYAFSERFVLPLSHD
EVVHGKGSLLAKMPGDAWQKLANLRAYFGFMWAHPGRKLLFMGGEFGQLGEWNHDATLEW
PLMQQHEHHGLAQLVGDLNARLKQEPALYRNDHTSEGFEWSVGDDSANSVFAFVRHDRDT
GAAPVLAVSNFTPMPRYDYRVGVPRAGQWHEILNTDSSHYGGSNVGNAGVVSTQPVPMHG
HAQSVALTLPPLATIWLKPD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggccacgggagcacaggaaacgaacgaccagtacgagacggtgccagcggat
ccgatgctggaggcgctggtccatggacacggcggtgatcccttcgcattgctgggccca
catgccaccgagcaggggaccgtgcgagtgcgcgcgatggcgcagggtgccgaagccatg
gccctgctcaatgccgagggcagggtggtagcactgatgcgctgcctggatccggccggg
ttgttcgaggccgaactcggtgcggccatgccctaccgcctgcgcatcgcctggccgggc
gccatacaggaaatgcaggatccgtacgcgttcggcccggtcctggaggacgcctggctg
cagggcatcctgtccggcgacggcgaagcggcgcggctggccctgggcgcgcatcggatg
acccacgaaggcgtcgatggtgtgcgttttgccgtgtgggcgcccaatgcgcgccgcgtg
tcgctggtgggcgatttcaacagctgggacgggcgtcgcaatccgatgcgcctgcgccac
aacggtggggtatgggaattgtttgtccccggcatcggcgccggcatgcgctacaagttc
gagatcaccgccttcgatggccagcgcctgccgcacaaggccgatccgatggcccgccag
tgcgagctgccgccggccaccgcctcggtggtgccgcaggccgagcaattcgcctggacc
gacgcgcagtggatggcccggcgcagcgcacgtgcgagcacacccgagccgatctccatc
tatgagttgcacgccggttcctggcgtcgcaccgccagcggcggactgatggactggcac
cagctggcggccgagctgattccctacgtgcgctggctggggttcactcacatcgaactg
atgccgatcaccgaatatccgtttggcggttcgtggggctaccagccactgggcatgtat
gcgccgaccgcgcggcacggcacgccggaaggctttgcccgcttcgtcgatgcctgccac
gaggccggcatcggcgtgattctggactgggtcagcgcgcactttcccaatgacgaacat
ggcctgcagcgcttcgacggcaccgcgctgtacgagcacgccgacccgaaggaaggtttc
caccgcgactggaacacgctcatctacaactatggccggcatgaagtgtcggcctacctg
gtgggcagcgcgctggagtggatcgagcgttaccacatcgatgggctgcgggtggacgcg
gtggcctcgatgctctaccgcgactacagccgcagcgaaggcgagtgggtgcccaaccag
cacggcggacgcgagaacctggaggcggtggccttcctcaagcggctcaacagcgaagtc
ggtcaccgcttccccggggtgatgatgatcgccgaggagtccaccgcctggggcggggtg
acgctgccgccggaacatggcggcctgggtttcacccacaagtggaacatgggctggatg
cacgacacgctggagtacatgaagcgtgaccccgtgcatcgcaggtaccaccacagcgaa
atgaccttcggcatgttgtacgcgttctccgagcgcttcgtgctgccgctctcgcatgat
gaagtggtgcacggcaagggctcgctgctggccaagatgccgggcgatgcctggcagaaa
ctggccaacctgcgtgcgtacttcggcttcatgtgggcgcacccgggacgcaagctgctg
ttcatgggtggcgagttcggacagctgggcgagtggaaccacgacgcgacgctggaatgg
ccgctgatgcagcaacacgagcaccacggcctggcgcagctggtgggcgacctcaacgca
cgcctgaagcaagagccggcgctgtatcgcaacgaccataccagcgagggcttcgaatgg
tcggtgggcgatgactccgccaacagcgtgttcgccttcgtccgccatgaccgcgacact
ggcgccgcgccggtgctggcggtgagcaacttcaccccgatgccgcgctacgactatcgc
gtcggcgtgccgcgcgccggccagtggcatgagatcctcaataccgacagcagccactac
ggcggctccaacgtgggcaatgccggtgtggtcagcacccagccggtgccgatgcacggc
catgcgcaatcggtggccctgaccttgccgccgctggcgacgatctggctgaaaccggac
tga

DBGET integrated database retrieval system