KEGG   Pseudoxanthomonas spadix: DSC_14760Help
Entry
DSC_14760         CDS       T01643                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSC_14760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_14760
   00020 Citrate cycle (TCA cycle)
    DSC_14760
   00620 Pyruvate metabolism
    DSC_14760
Enzymes [BR:psd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DSC_14760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3020547..3022001)
Genome map
AA seq 484 aa AA seqDB search
MAQAQEARVPDIGDYRDVPVIEVLVSVGDTVKKDQGLITLESDKATLEVPAAFGGVVKEL
KVKVGDTLSAGDVVALIEPQGESQAAAAKAEQEAEAAPAKAVAPSPARPVEPDAPVEPVD
TSPTPDKLTQREIAMSQSRTASGATSGQAEPPSPPTSTPPVSFDAARVMPDKVPHASPAV
RLFARELGVDLRQVTGSARHGRITREDVQGFVKQALAGGGASAAGGGNGLSPGSGPGQAL
LPWPKVDFSKFGQTEVKPLSRIQKISGANLARNWAMIPHVTQFDAADITELEDLRVALNQ
EAEKSRSGVKLTLLAFLIKASAALLKKYPTFNASLDASGENLTLKQYFHIGFAADTPNGL
VVPVIRDVDRKGINEIAAETGELAGKAREGKLGPAQMSGGCFSISSLGGIGGTAFTPIIN
APEVAILGVSRSSIQPVWDGKAFQPRLMLPLSLSYDHRVIDGALAARFTADLARVLGDMR
RVLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcccaggaagcacgcgttcccgacatcggtgactaccgcgacgtgcccgtg
atcgaggtgctggtctccgtcggggacacggtgaagaaggatcaagggttgatcaccctg
gagtcggacaaggccaccctggaagtgccggccgcgttcggcggtgtggtcaaggaactc
aaggtcaaggtcggcgataccctgtccgcaggcgacgtggtcgccttgatcgagccgcaa
ggcgaaagccaggccgccgcggccaaggccgaacaggaagccgaggcggcgccggcgaag
gccgtcgcgccgtcgccggccaggccggtcgaacccgacgcgccggtcgagccggtcgac
accagccccacgcccgacaagctgacccagcgcgagatcgcgatgtcgcagtcgcgcacc
gcctcgggcgcgacctccggccaggccgaaccgccatcgccgccgaccagcaccccgccg
gtgagcttcgacgccgcgcgggtgatgcctgacaaggtgccgcacgccagcccggccgtg
cgcctgtttgcccgcgagctgggcgtggacctgcgccaggtcaccggcagcgcccgccat
gggcgcatcaccagggaagacgtgcagggattcgtcaagcaggccctggccggtggcggc
gcgagcgccgccgggggtggcaacggcctgagccccggatcaggtcccgggcaggcgctg
ctgccgtggccgaaggtggacttcagcaagttcggccagaccgaggtcaagccgctcagc
cgcatccagaagatctccggcgccaacctggcccgcaactgggccatgatcccgcacgtc
acccagttcgatgcggccgacatcaccgagctggaagacctgcgcgtggcgctcaaccag
gaagcggaaaagtccaggtccggcgtcaagctgaccctgctcgccttcctgatcaaggcc
agcgccgcgctgctgaagaagtacccgaccttcaatgcctcgctggatgcctccggcgag
aacctcaccctgaagcagtacttccacatcggctttgccgccgacacccccaatgggctg
gtcgtgccggtgatccgtgacgtggaccgcaagggcatcaacgagatcgccgccgagacc
ggcgagctggccggcaaggcccgcgagggcaagctcggcccggcgcagatgagtggcggc
tgcttctcgatctcctcgctgggcggcatcggcggcaccgcattcacgccgatcatcaac
gcgccggaagtggcgatcctgggcgtgtccaggtcgtcgatccagccggtgtgggacggc
aaggccttccagccgcgcctgatgctgccgctgtcgctgagctacgaccatcgggtcatc
gacggcgcgcttgccgcgcgcttcaccgccgatctggccagggtcctgggcgacatgcgc
cgggtcctgctgtaa

DBGET integrated database retrieval system