KEGG   Pseudoxanthomonas spadix: DSC_15005Help
Entry
DSC_15005         CDS       T01643                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DSC_15005
Enzymes [BR:psd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DSC_15005
   3.1.2  Thioester hydrolases
    3.1.2.-  
     DSC_15005
Lipid biosynthesis proteins [BR:psd01004]
 Fatty acid synthase
  Component type
   DSC_15005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3067899..3068567
Genome map
AA seq 222 aa AA seqDB search
MQAGYAVVRRRAQWWLALVVMTFMQALLAQPAPRAATAATTKTVLVMGDSLSAGYGLGPN
EGWVPLTAARIAREKPGWKVVNASISGETSAGGASRIGAQLQRLKPAVVVIELGANDGLR
GLPLDQTRANLEKMITASQAAGARVLLLGMQMPPNLGRTYTEGFASLYSALARQYHTAFV
PFFLQPIAGDRANFQADNLHPTTEVQPQIRDFVWPALAPLLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaggttatgcggtcgtgcgccgccgcgcgcaatggtggctggcgctggtggtg
atgacattcatgcaagcgctgctggcccagccagcgccccgggccgccaccgcggcgacc
accaaaaccgtgctggtgatgggcgactcgctgtcggccggctacgggctgggcccgaat
gagggctgggtgccgctgaccgccgccaggatcgcccgcgaaaaacccggctggaaagtg
gtcaacgccagcatcagcggcgagaccagcgccggtggcgcctcgcgcatcggcgcccag
ctgcagcggctcaagccggccgtggtggtgatcgaactgggcgccaacgatggcctgcgc
ggcctgccgctggaccagacccgggccaacctggagaagatgatcaccgcctcgcaggcc
gccggcgcccgggtgctgctgttgggcatgcagatgccgcccaacctgggccggacctat
accgagggctttgccagcctctacagcgcgctggcccggcagtaccacaccgcgttcgtc
ccgttcttcctgcagcccatcgccggcgaccgggccaacttccaggccgacaacctgcat
cccaccaccgaagtgcagccgcagatccgcgacttcgtctggcctgcgctggcgccgttg
ctgaaataa

DBGET integrated database retrieval system