KEGG   Pseudoxanthomonas spadix: DSC_15715Help
Entry
DSC_15715         CDS       T01643                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00010  Glycolysis / Gluconeogenesis
psd00020  Citrate cycle (TCA cycle)
psd00620  Pyruvate metabolism
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
psd01200  Carbon metabolism
Module
psd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_15715
   00020 Citrate cycle (TCA cycle)
    DSC_15715
   00620 Pyruvate metabolism
    DSC_15715
Enzymes [BR:psd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DSC_15715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SspP
Motif
Other DBs
NCBI-ProteinID: AER57787
UniProt: G7UWU0
Position
3221458..3222888
Genome map
AA seq 476 aa AA seqDB search
MSQTKTFLLPDLGEGLPDATIVEWFVREGDTVALDAPLVSMETAKAVVEVPSPVSGKVLR
LAGAAGEVVPTGAMLAEFELDPNRPQRADGQDTGHSHAAPKPASAAASPAPAPAPMPAVE
SFDHERDDAGTVVGAMQASDAVQVQAAVAVGGVKAMPAVRAMARKLGVDLARVRATGADG
VVTMADVKQAAADGSLLLPSPAGATVHGMRATGAHASERPRDERGPGRGAGAGGEGAAAG
HVAARTALSASGKPMRTQPPGVVASGQPEPLKGVRRNMARVMADAHAKVVATTLNDDADV
QAWTPASDVTARLVRGIVAACTAVPAMNAWFDGDALTRTLHPHVDIGIAVDTDEGLFVPA
LRNADLLDARGVREGVNRLRTQVLERSLPASELTGYTISLSNFGMFAGRYATPIVVPPCV
AIVAAGRARFQMTPVMGGFESRKVIPLSVTFDHRACTGGEAARFLRALIDDLALAD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaccaagaccttcctccttcccgacctgggcgagggcctgcccgatgcaacc
atcgtcgagtggttcgtcagggaaggcgacaccgttgccctggacgcgccgctggtgtcg
atggagacggccaaggccgtggtcgaagtgccctcgccggtgtcgggcaaggtgctcagg
ctggccggtgcggccggcgaggtggtgccgaccggggcgatgctggccgagttcgaactg
gacccgaatcgcccgcagcgcgccgatggccaggacaccggccattcgcacgccgcgccc
aagcctgcgtctgctgccgccagcccggcaccggcgccggcaccgatgccggcggtggag
tcgttcgaccacgaacgcgacgatgccggcaccgtggtcggggcgatgcaggcttccgac
gcggtgcaggtccaggcagcggtggccgtgggcggggtcaaggcgatgccggccgtgcgc
gcgatggcgcgcaagctgggcgtggacctggcccgggtgcgcgccaccggcgccgatggc
gtggtgaccatggccgatgtgaagcaggccgccgccgacggttcgctgttgctcccctct
cccgccggggcgacggtgcacggcatgcgcgccactggcgcgcatgcatcggagcgcccg
cgcgacgagcgcgggccggggcgcggagcgggggccgggggtgagggtgcggccgccgga
cacgtcgccgcccgcaccgcgctgtcggccagcggcaaaccgatgcgcacgcagcctccc
ggcgtggtggcaagcggccagcccgagccgctcaagggcgtgcgccgcaacatggcccgg
gtcatggccgatgcccacgccaaggtcgtggccaccaccctcaacgacgacgccgacgtg
caggcctggacgcctgccagcgatgtcaccgcgcgcctggtgcgcgggatcgtcgccgcc
tgcacggcggtgccggcgatgaacgcctggttcgacggcgatgcgctgacccgcaccctg
catccgcacgtggacatcggcatcgccgtggacaccgacgagggcctgttcgtgccggcg
ctgcgcaatgccgacctgcttgacgcgcgcggggtgcgcgaaggcgtcaaccgcctgcgc
acgcaggtgctcgaacgcagcctgccggccagcgaactgaccggctacacgatctcgctg
tccaacttcggcatgttcgccggccgctatgccaccccgatcgtggtcccgccgtgcgtg
gccatcgtcgccgccggccgggcgcgcttccagatgaccccggtgatgggcggtttcgaa
tcgcgcaaggtgatcccgctgtcggtcaccttcgaccaccgcgcctgcaccggcggcgaa
gccgcgcgcttcctgcgcgccctgatcgacgacctggccctggccgactga

DBGET integrated database retrieval system