KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0091Help
Entry
NH8B_0091         CDS       T01619                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NH8B_0091 (glpK)
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NH8B_0091 (glpK)
Exosome [BR:pse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NH8B_0091 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103947..105431
Genome map
AA seq 494 aa AA seqDB search
MTATLLVIDQGTTSTRAMLFDAGGRVLARAQRELPQHFPQPGWVEHEPEDIWRDTLALAR
EVLAHGATPVALGLTNQRETTLLWERASGRVLHRAIVWQDRRTAEHCAALATPDNAALVS
AKTGLVLDPYFSASKLAWLLDHVPGARERAERGELAFGTVDSFLLWRLTEGRVHATDASN
AARTLLFNIHTQEWDDELLALFAIPRALLPEVRDNVADYGVTTLFGQPLKITALAGDQQA
ATVGQACFEPGMIKSTYGTGCFLVQNTGNEVLASRHRLLSTVCYRLEGRTTYALEGSIFV
AGAALQWLRDAVRLIHSAGESETLARQLADTGGVYLVPAFTGLGAPYWDPLARGAIIGLT
RDSGIAHIVRAALESVCYQTRDLMEAMQADGAARPASLRVDGGMVGNDWLMQFLADMLAV
PVERAAVSETTALGAAFLAGLGAGVYGSLDELAALWRRQQRFEPGMSEERRAMLYQGWRV
AVARTLSQPESLAR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacactgctggtaatcgaccagggcaccaccagcacccgcgccatgctgttc
gatgccgggggccgggtgctggcccgcgcccagcgcgagctgccgcagcactttccgcag
ccgggctgggtggagcacgagccggaggacatctggcgcgacacgctggcactggcgcgc
gaggtactggcgcacggggccactccggtggcgctgggactcaccaaccagcgcgagacc
acgctgttgtgggaacgcgccagcggccgggtgctgcatcgcgccatcgtgtggcaggac
cggcgcaccgccgagcactgtgccgcgctcgccacgccggacaacgccgcgctggtgagc
gccaaaaccggcctggtgctcgacccctacttctccgccagcaagctcgcctggctgctc
gaccacgtccccggcgcgcgcgaacgcgccgagcgcggcgagctggcgttcggcaccgtc
gatagcttcctgctgtggcgcctgaccgaagggcgggtgcacgccaccgacgccagcaac
gccgcgcgcaccttgctgttcaacatccacacccaagagtgggatgacgagctgttggcg
ctgttcgccatcccgcgcgcgctgctgccggaggtgcgcgacaacgtcgccgactacggg
gtcaccaccttgtttggccaacccctgaagatcactgcgctggccggcgaccagcaggcc
gccaccgtcggccaggcctgcttcgagccgggcatgatcaagtccacctacggcaccggc
tgctttctggtgcagaacaccggtaacgaggtgctggcgtcgcgccaccgcctgctgtcg
acggtgtgctaccggctggaaggacgcaccacctacgcgctggaaggcagcatcttcgtc
gccggcgccgcgctgcaatggctgcgcgacgcggtacggctgatccactcggccggcgag
agtgaaacgctggcacgccagctggccgacaccggcggcgtctacctggtgccggcgttc
accgggctgggggcgccgtactgggacccgctggcgcgcggcgccatcatcggcctgacg
cgcgactccggcatcgcccacatcgtgcgcgccgcgctggagtcggtgtgctaccagacg
cgtgacctgatggaggcgatgcaggccgacggcgcggcgcgccccgccagcctgcgcgtc
gacggcggcatggtcggcaacgactggctgatgcagttcctggccgacatgctggcggtg
ccggtggaacgcgcggcggtgagcgaaaccaccgcgctcggggcggcgttcctggcgggg
ctgggggcgggggtgtacggctcgctcgacgagctggcggcgctgtggcggcgccagcag
cgcttcgagccgggcatgagcgaggagcggcgcgcgatgctgtaccagggctggcgggtg
gcggtggcgcgcaccctgagccagccggaaagcctggcccgttag

DBGET integrated database retrieval system