KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0117Help
Entry
NH8B_0117         CDS       T01619                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_0117 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_0117 (glk)
   00052 Galactose metabolism
    NH8B_0117 (glk)
   00500 Starch and sucrose metabolism
    NH8B_0117 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NH8B_0117 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NH8B_0117 (glk)
   00524 Butirosin and neomycin biosynthesis
    NH8B_0117 (glk)
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NH8B_0117 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137140..138123
Genome map
AA seq 327 aa AA seqDB search
MFTGRPDSFPWLVADIGGTNARFALYTGGAEPEQIKVLACADYPTLEAAVRAYLADVGAT
VRHASIGIANPVTGDWVQMTNHHWAFSIEATRQALALESFLVINDWAAMALALPHLPADA
LIKVGGGEAVPGAPCALIGPGTGLGVSALVPHAHGATPVPGEGGHVSFAPFDEREAQIWH
FARERYGHVSAERLLSGPGLVLIYQALAALAGEEAEDLRAADISTRALSGECPRCRETLD
AFCAMLGTAAANLTLTLGARGGVYLGGGIVLRLLDYFQSSPFRARFEDKGRFSGYLAAVP
VYIMTHAMPALLGATAALAAHLEEQHA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgggcgtcctgatagctttccctggctggtcgccgatatcggcggcaccaat
gcccgtttcgcgctctacaccggcggcgccgaaccggaacagatcaaggtcctggcctgc
gccgactacccgacgctggaagcggcggtgcgcgcctacctcgccgacgtcggcgccacg
gtgcggcatgcctccatcggcatcgccaacccggtcaccggcgactgggtgcagatgacc
aaccaccactgggcgttctcgatcgaagccacgcgccaggcgctggcgctggagtccttc
ctggtgatcaacgactgggcggcgatggcgctggccttgccgcacctgccggccgacgcg
ctgatcaaggtcggcggcggcgaggccgtgcccggcgcgccgtgcgcgctgatcgggccc
ggcaccgggctcggcgtctcggcgctggtgccgcacgctcacggcgccaccccggtgccg
ggcgagggcggccacgtcagcttcgccccgttcgacgagcgcgaggcgcagatctggcac
ttcgcgcgcgagcgttacggccacgtctcggccgagcgcctgctgtccggccccggcctg
gtactgatctaccaggcgctcgccgcgctggccggcgaggaggccgaagacctgcgcgcc
gccgacatctccacccgcgccctgtccggcgaatgcccgcgctgccgcgagacgctggac
gcattctgtgccatgctcggcaccgcggcggccaacctgacgttgacgctgggcgcccgc
ggcggggtctacctcggcggcggcatcgtgctgcgcctgctcgactacttccagagctcg
ccgttccgtgcccgtttcgaagacaaggggcgcttttccggctacctcgcggcggtgccg
gtgtacatcatgacgcacgccatgccggcgctgttgggcgccaccgccgcgctggccgcg
cacctggaggagcagcatgcttga

DBGET integrated database retrieval system