KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0167Help
Entry
NH8B_0167         CDS       T01619                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NH8B_0167
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NH8B_0167
Enzymes [BR:pse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NH8B_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188367..189860
Genome map
AA seq 497 aa AA seqDB search
MKSLLTPLPDWDPAELDTLGLPLKRVETDSRRVLPGDVFLACRGEYADGRQFIPMALANG
AACVLWDPADGFNWNPAWNVPNLAVPQLRARAGIVASHAYGEPSRAMTVIGITGTNGKTS
ISHWLAQAFSLLAHKAALIGTVGNGFYGALTETTHTTPDPVTVQQKLAEYKRQGADVVTM
EVSSHGLDQFRVNGVSFATAVFTNLTRDHLDYHGSMEEYGASKARLFHWEGLRHAIINAD
DAFGRELAAGIDRQRTQTVTYGLEQGDVRAQNLSATLDGLQMTVTTPWGEGELRSPLLGR
FNAANLLACLATLCVNGVSLKDAAAVLSRIQPARGRMQRLGGGHEPLVVIDYAHTPDALE
KALATLAEIRPAGNRLYCVFGCGGDRDKGKRPMMGAIATRIADVAVVTSDNPRSEEPQAI
IADIRAGMGETGHVEADRAAAIRWAIAAARAGDIVLVAGKGHEEYQDIRGVKQPFSDFRI
AEEALTAWSEVHDADAV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtctgttgaccccgctaccggactgggatccggccgagctcgataccctgggg
ctgccgctcaagcgtgtcgagacggacagccgccgcgtgctgccgggcgacgtgttcctg
gcgtgccgcggcgagtacgccgacggccgccagttcattccgatggcgctcgccaacggt
gccgcctgcgtgctgtgggacccggccgacggctttaactggaacccggcctggaacgta
cccaacctggcggtgccgcagctgcgcgcgcgcgccggcatcgtcgccagccacgcctat
ggcgagccgagccgcgccatgacggtgatcggtatcaccggcaccaacggcaagacctcg
atctcgcactggctggcgcaggcgttctcgttgctagcgcacaaggcggcgctgatcggc
accgtcggcaacggcttctacggcgccctgaccgagaccacccataccacgccggacccg
gtgacggtgcagcagaagctggccgagtacaagcgccagggcgccgacgtggtgaccatg
gaagtgtcctcgcacggtctcgaccagttccgcgtcaacggcgtcagcttcgccaccgcg
gtgttcaccaacctgacgcgcgaccacctcgactatcacggctcgatggaagaatacggc
gcctccaaggcgcggctgttccattgggaagggctgcgccacgccatcatcaacgccgat
gatgccttcggccgcgagctggccgccggtatcgatcgccagcgcacccagacggtgacc
tacgggttggagcagggcgacgtgcgcgcgcagaacctgtccgccaccctcgacggcctg
cagatgacggtgaccacgccgtggggcgagggcgagctgcgcagcccgctcttgggccgt
ttcaacgccgccaacctgctcgcctgtctcgccacgctgtgcgtcaacggcgtgtcgctg
aaggacgcggcggcggtgctgtcgcgcatccagccggcgcgcgggcgcatgcagcgcctg
ggcggcggtcacgagccgctggtggtgatcgactacgcccacaccccggacgcgctggag
aaggcgctggccacgctggccgagatccgccccgccggcaaccggctctactgcgtgttc
ggctgcggtggcgaccgcgacaagggcaagcgcccgatgatgggagccatcgccacccgc
atcgccgacgtcgcggtggtgaccagcgacaacccgcgcagcgaagagccgcaggccatc
atcgccgacatccgcgccggcatgggtgagaccggccacgtcgaggccgaccgtgccgcc
gccatccgctgggcgatcgccgcggcgcgcgccggcgacatcgtgctggtggccggcaag
gggcacgaggaataccaggacatccgcggcgtgaagcagccgttctccgatttccgcatc
gccgaagaggcgctcacggcctggagcgaggtgcacgatgctgatgctgtctga

DBGET integrated database retrieval system