KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0220Help
Entry
NH8B_0220         CDS       T01619                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pse00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pse00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248616..249389
Genome map
AA seq 257 aa AA seqDB search
MTRTAFITGSTSGIGLAVACRLAANGWAIGLHGLATPEQRDEALGMVRQAGAADAAFFDG
DLRDPAAVQGLAEAVQRWRPVDVLVNNAGMQHTASVAAMPAELWQAILAVNLSAAFFLMQ
ALLPGMAGRGWGRVVNIASVHGLVASVNKAPYVASKFGLVGLTKVAALEYAQSGVTVNAI
CPGWVETALIEPQIQARAAAFGGDRDAGLKALVLDKQPSGRMSQPSDIGEAVAMLCGDWA
HNLTGVALPIDGGWSAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgccttcatcaccggttccacttccggcatcggcctggccgtcgcctgc
cgtctcgccgccaacggctgggccatcggcctgcacggcctggccactcccgaacagcgc
gacgaggcgctgggcatggtgcgccaggccggcgccgccgacgccgcgttcttcgacggc
gatctgcgcgaccccgccgcggtgcaggggttggccgaagcggtgcagcgctggcgtccc
gtcgacgtgctggtcaacaacgccggcatgcagcacaccgcgagcgtggcggcgatgccg
gccgagctgtggcaggccatcctcgccgtcaacctgtcggccgcgttcttcctgatgcag
gcgctgctgcccggcatggcggggcgcggctgggggcgcgtggtcaacatcgcctcggtg
cacgggctggtggcgtcggtcaacaaggcgccgtacgtggcgagcaagttcgggctggtc
gggctgaccaaggtggcggcgctggaatacgcgcagagcggggtgacggtgaacgcgatc
tgcccgggctgggtggagaccgcgctgatcgagccgcagatccaggcgcgcgcggccgcc
ttcggcggcgaccgtgacgccggcctgaaggcgctggtgctggacaagcagccgtccgga
cgcatgagccagccgtccgacatcggcgaggcggtggcgatgctctgcggcgactgggcg
cacaacctgaccggagtggcgctgccgatcgacggcggctggagcgcgcagtag

DBGET integrated database retrieval system