KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0319Help
Entry
NH8B_0319         CDS       T01619                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NH8B_0319 (ruvA)
Enzymes [BR:pse01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NH8B_0319 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347461..348054
Genome map
AA seq 197 aa AA seqDB search
MIGRLTGQLIEKLPPQIVVDVGGVGYEVDVPMSTFYLLPALGEKTTLYTHLVVREDAHLL
FGFASKGERETFRQLIKVGGIGAKIALAILSGLSADELALAVASEDLKRLSSVPGIGKKT
AERLVLELRGKLATGGAVTTPGGLPFAATPGDKSDIVNALLALGYNDKEAAAATKGLPPE
VTVSDGVRLALKSLMKG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcctcacaggtcaactcatcgaaaaactcccgccgcagatcgtggtggac
gtcggcggcgtcggctacgaagtcgacgtgccgatgagcaccttctacctgctgcccgcg
ttgggcgagaaaaccacgctctatacccacctggtggtgcgcgaggacgcccacctgctg
ttcggcttcgccagcaagggtgagcgcgaaaccttccgccagctgatcaaggtcggcggc
atcggcgccaagatcgcgctggccatcctgtccgggctgagcgccgacgaactggcgctg
gcggtggccagcgaagacctcaaacgcctctccagcgtccccggcatcggcaagaagacc
gccgagcgcctggtgctggagctgcgcggcaagctcgccaccggcggcgccgtgaccacc
ccgggcggcctgccgttcgccgccacgccgggcgacaagagcgacatcgtcaacgcgctg
ctggcattgggctacaacgacaaggaagccgccgccgccaccaagggcctgccacccgag
gtgacggtgagcgacggcgtgcgtctggcgctcaagagcctgatgaaagggtga

DBGET integrated database retrieval system