KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0386Help
Entry
NH8B_0386         CDS       T01619                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH8B_0386
   00330 Arginine and proline metabolism
    NH8B_0386
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NH8B_0386
Enzymes [BR:pse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NH8B_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(402373..403287)
Genome map
AA seq 304 aa AA seqDB search
MDYQTLLDEIAQDIVPYFGLGKVANYIPALAKINPQQFAISIATLDGQQYSTGQTDTRFS
IQSLSKVFMLSLVLGRLGDNLWTRVGKEPSGNPFNSLIQLENENGIPRNPFINAGALVVT
DLANSLYGEAKAVLLDFLRQESGADDLAFDLEVAQSEQQHGDRNAALAHFMKSYGNMVNP
VERTLDSYFHSCSITMSCAELARAGLYLANHGLSPVSGQQRLSRSQAKQVNAIMLTCGTY
DAAGEFAYRVGLPCKSGVGGGILAVIPGKLSMAVWSPALDSQGNSLIGLEALDRFTTRTG
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggattatcagaccctcctcgatgaaatagcgcaggatatcgtcccctatttcggactg
ggcaaggtggcgaactacatccccgccctggccaagatcaacccacagcagttcgccatc
agcatcgccacgctcgacggccagcaatactccaccggccagaccgacacccggttctcg
attcagagcctgtccaaggtgttcatgctgtcgctggtgctgggacgtcttggcgacaac
ttgtggacccgcgttggcaaggaaccgtcgggcaaccccttcaactcgctgatccagctg
gaaaacgagaacggcattccccgcaatcctttcatcaacgccggtgcgctggtggtgacc
gatctcgccaactcgctgtacggcgaagccaaggcggtgctgctggatttcttgcgtcag
gaaagcggcgccgacgacctcgccttcgatctcgaggtggcgcagtccgagcaacagcac
ggtgaccgtaatgccgcactggcgcacttcatgaaaagctacggcaacatggtcaatccg
gtagagcgcacgctagacagctacttccacagctgcagcatcaccatgagctgcgccgaa
ctcgcccgcgccggcctctacctcgccaaccacggactctccccggtcagcggccagcag
cgcctgagccgcagccaggccaagcaggtcaacgccatcatgctcacctgcggcacctac
gacgccgccggtgaattcgcctaccgggtcgggctaccatgcaaaagcggcgtgggggga
ggcatcctggcagtgatccccggcaagctgagcatggcggtgtggagcccggcgctcgac
agccaaggcaattcgctgatcgggctggaagcgctcgaccgtttcaccacccgcaccggg
ctatccattttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system