KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0457Help
Entry
NH8B_0457         CDS       T01619                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_0457
  Energy metabolism
   00680 Methane metabolism
    NH8B_0457
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NH8B_0457
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     NH8B_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479577..480773
Genome map
AA seq 398 aa AA seqDB search
MSDNRGVVYLGQGHVEVQSIGYPKMVDPSGRPIGHGVILKVVTTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEIGRDVETLKIGDLVSVPFNVACGRCTTCKEQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQSEYVMVPYADFNLLKFPDKDKAMEKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNPERLAHARAVGFETVDLSLD
ATLGEQIAAILGTPEVDCAVDCVGFEARGHGTHAHEEAPATVLNSLMEVTRVAGAIGIPG
LYVTDDPGATDAAAKRGSLSIRFGLGWAKSHSFHTGQTPVMKYNRNLMQAILWDRLPIAQ
IVNVSVISLDEAPNGYRQFDGGAPRKFVIDPHGTLKSA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatcgcggtgtggtgtatctggggcaaggtcatgtcgaggtgcaatccatc
ggctacccgaaaatggtcgatccgagcggccggccgatcggccacggcgtcatcctcaag
gtggtgacgaccaatatctgcggctcggaccagcacatggtgcgcggccgcaccacggcc
gaggtcgggctggtgttgggccacgaaatcaccggcgaggtgatcgagatcggccgcgac
gtcgagacgctgaagatcggcgacctggtgtcggtgccgttcaacgtggcgtgcggccgc
tgcaccacgtgtaaggaacagcacaccggggtgtgcctgaacgtcaacccgtcgcgcgcc
ggtggcgcctacggctacgtcgacatgggcggctggatcggcggccagtccgagtacgtc
atggtgccgtacgccgacttcaacctgctcaagttcccggacaaggacaaggcgatggag
aagatccgcgatctgacctgcctgtccgacatcctgcccaccggctaccatggcgcggtg
acggccggggtgaaaccgggctcgaccgtctacatcgccggcgccggtccggttggtatg
gccgctgccgcttcggcgcgtctgctgggcgccgcggtgaccatcgtcggcgacatgaac
cccgaacgtctggcgcacgcccgtgcagtgggcttcgagaccgtggacctgtcgctcgac
gccacgctgggcgagcagatcgcggccatcctcggcacccccgaggtggattgcgcggtg
gactgcgtcggcttcgaagcgcgcggccacggcacgcacgcccacgaagaggcgccggcc
acggtgctcaactcgctgatggaggtcacccgcgtggccggtgccatcggcattccgggc
ctgtacgtgaccgacgacccgggcgcgaccgacgccgccgccaagcgcggcagcctgtcc
atccgcttcggtctgggctgggccaagtcgcactccttccataccggccagaccccggtg
atgaagtacaaccgcaacctgatgcaggccatcctgtgggaccgtctgccgatcgcccag
atcgtcaacgtcagcgtgatctcgctcgacgaggccccgaacggctaccgtcagttcgac
ggcggcgcgccgcgtaaattcgtcatcgacccgcacggcacgctcaagtcggcctga

DBGET integrated database retrieval system