KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0477Help
Entry
NH8B_0477         CDS       T01619                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NH8B_0477
   00052 Galactose metabolism
    NH8B_0477
   00500 Starch and sucrose metabolism
    NH8B_0477
   00520 Amino sugar and nucleotide sugar metabolism
    NH8B_0477
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NH8B_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502042..502914
Genome map
AA seq 290 aa AA seqDB search
MKKITKAVFPVAGMGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITELIFITGRN
KRSIEDHFDKAYELETELEYKNKQKLLDLVQGILPPSVTCIYIRQTEALGLGHAVLCARP
VVGDEPFAVILADDLIDGEPGAMAQMVATFDEQQCSVLGVETVAPEETGSYGIVEVQCDA
TGLQRISSIVEKPHPDVAPSNLAVVGRYILTPRIFDKLAKTQAGAGGEIQLTDGIAELLK
DETVLALPFNGVRYDCGSKLGYLKATINYGLKHHEVGREFADYLATFNAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattaccaaagccgtgttcccggtcgccggtatgggcacccgcttcctgccc
gcgaccaaggcgagccccaaggaaatgctgccggtggtcgacaagccgctgatccagtac
gcggtcgaggaggccatcgctgccggcatcaccgagctgattttcatcaccgggcgtaac
aagcgctccatcgaagaccacttcgacaaggcctacgagctcgaaaccgagctggagtac
aagaacaagcagaagctgctggatctggtgcagggcatcctgccgccgtcggtcacctgc
atctacatccgtcagaccgaggcgctcggcctcggccacgccgtgctgtgcgcccggccg
gtggttggcgacgagccgttcgcggtgatcctcgccgacgaccttatcgatggcgagccc
ggtgccatggcgcagatggtcgcgaccttcgatgagcagcagtgctcggtgctgggggtg
gaaacggtcgcgccggaagaaaccggctcctatggcatcgtcgaagtgcagtgcgatgcc
actggcctgcaacgcatcagcagcatcgtcgagaagccgcacccggacgtggcgccgtcc
aacctcgccgtagtgggacgctacatcctgaccccgcgcatcttcgacaaactggccaag
acccaggccggtgccggcggcgaaatccaactcaccgatggtatcgccgaactgctcaag
gacgaaaccgtgctggcgctgccgttcaacggcgtacgctacgactgcggctccaagctg
ggttacctcaaggccaccatcaactacggtctgaaacaccacgaggtcggccgtgaattc
gcggactatctcgctaccttcaacgcgcgctga

DBGET integrated database retrieval system