KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0612Help
Entry
NH8B_0612         CDS       T01619                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_0612
   01230 Biosynthesis of amino acids
    NH8B_0612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_0612
   00051 Fructose and mannose metabolism
    NH8B_0612
   00562 Inositol phosphate metabolism
    NH8B_0612
Enzymes [BR:pse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NH8B_0612
Exosome [BR:pse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NH8B_0612
  Exosomal proteins of bladder cancer cells
   NH8B_0612
  Exosomal proteins of melanoma cells
   NH8B_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616318..617031
Genome map
AA seq 237 aa AA seqDB search
MHGRHAFNAQLVAQLLASESVNRSGVAIAVPTPYLVSVESLLGGQGLVLAAQDVSRFAED
GAFTGESSANMLADVGCRYVLVGHSERRQYLGEGSEALSLKLRNAIAAGLTPVYCVGETL
AEREADRHLAVIREQLSVLDGVDGGPVVVAYEPVWAIGTGKVASLEQIDEIHREIKAECL
RRLKGSANIRVLYGGSVKADNAMAILSLDNVDGALVGGASLVPESFSMICQTARKLI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcatgggcgccatgcgttcaacgcgcaattggtggcgcaattgttggcgtcggagtcg
gtcaaccgttccggcgtcgccatcgcggttcccactccctacctggtgtcggtcgaatcc
ttgcttggcgggcagggcctggtgctggcggcccaggacgtcagtcgcttcgccgaagac
ggtgcctttaccggagaaagctcggccaacatgctggctgacgttggctgccgctacgtg
ttggtaggccattccgagcgccgtcagtatcttggtgaaggcagtgaggcgctgagtctg
aagctgcgcaacgccatcgcggccggcctcactccggtatattgcgttggcgagactctg
gctgagcgcgaagcggatcgtcatctcgccgtaatccgcgagcagttgtcggtgctcgac
ggcgtcgacggcgggccggtggtggtggcctatgagccggtatgggcgatcggtacgggc
aaggtggccagtctcgagcagatcgacgaaatccaccgtgaaataaaggccgaatgcttg
cgccggctcaagggctctgctaatattcgcgtcctctacggcggcagcgtcaaagcagac
aatgcgatggcaatcctgtctctcgataatgttgacggggcgctggtagggggtgcatcc
ctggttccagagtcgttttcgatgatttgccaaaccgctagaaaattgatatag

DBGET integrated database retrieval system