KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0720Help
Entry
NH8B_0720         CDS       T01619                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NH8B_0720
   00565 Ether lipid metabolism
    NH8B_0720
   00590 Arachidonic acid metabolism
    NH8B_0720
   00591 Linoleic acid metabolism
    NH8B_0720
   00592 alpha-Linolenic acid metabolism
    NH8B_0720
Enzymes [BR:pse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NH8B_0720
    3.1.1.32  phospholipase A1
     NH8B_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733009..734088
Genome map
AA seq 359 aa AA seqDB search
MSILRWLPGLSLLLPLMSHAESTEEALGRCAALPAAEARLACFDAAATAARPPATALATA
PALAEPAVNTTEAMPAPAAVPPAAEERAEPVPESTALAKLWDLDQDAPHRTFLLRGHRPS
YFLPGWYQVAPNTAPSTPTHGATAQDLDHTEVKFQLSFKSKIWQNVLGTPADLWFGYTQQ
SHWQLYNKPQSSPFRETDYEPEAMASLPVDWSVLGWRVRLLGAGFVHQSNGQSDPLSRSW
NRVYGMLGMERGPLTLTARVWQRLPEPVESDDNPDILRYYGYGDLQAQYRWNDHTLAALA
RYNPSSGKGALQLGWTFPLAGRLRGYLQYFNGYGESLIDYNHRNQGIGFGLMLNDWAQG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctgcgctggctgccgggtttgtcgctcctgctgccgctgatgagccatgcc
gagagcaccgaggaggcgctgggccgatgcgccgccttgcccgcggccgaggcacggctc
gcctgcttcgacgctgccgccacggcggcccggccgcctgccaccgccctcgccaccgct
ccggccttggcggagcctgccgtaaacaccaccgaagcaatgcccgcgcctgctgccgtt
cctcctgcagcggaagagcgtgccgagccggtgccggagagcacggcgctggccaagctg
tgggatctggatcaggacgctccgcaccgtaccttcctgctgcgcggccaccggccctcg
tatttcctgcccggctggtaccaggtcgctcccaacacggccccgtccacgccgacgcac
ggcgccactgcgcaggatctcgaccacaccgaagtcaagttccagctctcgttcaagagc
aagatctggcagaacgtgctgggcacgccggccgacctgtggttcggctatacccagcag
tcgcactggcagctctacaacaagccgcagtcgtcgccgtttcgcgaaaccgactacgaa
cccgaagccatggccagcctgccggtcgattggtccgtgctgggctggcgagtgcggctg
ttgggcgccggcttcgtgcatcagtccaacggccagagcgacccgttgtcgcgcagctgg
aaccgggtgtacggcatgctcggcatggagcgcggtccgctgacgctgacggcgcgcgtg
tggcagcggctgccggagccggtagagagcgacgacaaccccgacatcctgcgctactac
ggctatggcgacctgcaggcccagtatcgctggaacgaccataccctggcggcgctggcg
cgctacaacccgtcgtccggcaagggggcgctgcaactgggctggaccttcccgctcgcc
ggccggctgcgcggctacctgcagtacttcaatggctacggcgagagcctgatcgactac
aaccaccgtaaccagggcatcggcttcggcctgatgctcaacgactgggcgcagggctga

DBGET integrated database retrieval system