KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0834Help
Entry
NH8B_0834         CDS       T01619                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_0834
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NH8B_0834
   00630 Glyoxylate and dicarboxylate metabolism
    NH8B_0834
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NH8B_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(850979..853144)
Genome map
AA seq 721 aa AA seqDB search
MTQRTPCHRLQVATVLHAFIEQEVLPGSGIGSAAFWSGFDVLVHELAPKNRALLAERDRL
QSEIDAWHRQHPGPIADMAAYKAFLTSIGYLKPVPADGRISTSNIDSEIAEQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAIAEDDGASRSGGYNPVRGTKVIAFGRDFLDASA
PLETGSHHQAAAYRVAGGQLQVELQDGRTSSLKQPELFLGYNGDAAAPTSVLLKQNGLHF
EIQIDKSSPIGAQDGAGVKDIVMEAAITTIMDCEDSVAAVDADDKVVVYRNWLGLMQGTL
TEEVSKGGKTFTRTLNPDRRYTAADGSALTLHGRSLMFVRNVGHLMTNPAILDGDGHEVP
EGIMDAVVTTLIALHDQQRRGNSRAGSIYIVKPKMHGPDEVAFADELFGKVEQLLGLPQY
TVKLGIMDEERRTSVNLKACIAAARHRVAFINTGFLDRTGDEMHTSMEAGPMIRKGDMKT
SKWIAAYERNNVQVGLDCGLRGHAQIGKGMWAMPDLMAEMLKQKIGHPKAGANTAWVPSP
TAAVLHALHYHQVDVQEVQKALEGQYADLQDDLLTIPVAANPNWSAEDIQQELDNNAQGI
LGYVVRWIDQGVGCSKVPDIHNIGLMEDRATLRISSQHIANWLRHGIVTEAQVKETLQRM
AAVVDGQNAGDPAYQPMAPAFDTSIAFKAACDLVFQGCAQPSGYTEPLLHHWRQVEKAHA
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgaaccccttgccatcgactgcaggttgccaccgtcctccacgccttcatc
gaacaggaagtcctgccgggcagcggcatcggctccgccgcgttctggtccggtttcgat
gtcctggtgcacgaactggcgccgaagaaccgcgccctgctcgccgagcgcgaccgcctg
cagagcgaaatcgatgcctggcaccgccagcatccgggcccgatcgcggacatggccgcc
tacaaggcgttcctcacctccatcggctacctgaagccggtgccggccgacggccgcatc
agcaccagcaacatcgacagcgaaatcgccgagcaggccggcccgcagctggtggtgccg
gtgatgaacgcgcgctacgccctgaacgccgccaacgcgcgctggggcagcctgtacgac
gcgctgtacggcaccgatgccatcgccgaggacgatggcgccagccgcagcggcggctac
aacccggtgcgcggcaccaaggtgatcgccttcggccgtgacttcctcgacgccagcgcg
ccgctggaaaccggttcgcaccaccaggctgcggcctaccgcgtggccggcggccagctg
caggtcgagctgcaggacggccgcaccagctcgctcaagcagccggagctgttcctcggc
tacaacggcgacgccgccgcgccgacctcggtgctgctcaagcagaacggcctgcacttc
gagatccagatcgacaagagcagcccgatcggcgcccaggacggcgccggggtcaaggac
atcgtgatggaagccgccatcaccaccatcatggactgcgaggactcggtcgccgcggtc
gatgccgacgacaaggtcgtggtgtaccgcaactggctcggcctgatgcagggcacgctg
accgaagaagtgagcaagggcggcaagaccttcacccgcaccctcaacccggaccgccgc
tacaccgccgccgacggcagcgcgctgacgctgcacggccgcagcctgatgttcgtgcgc
aacgtcggccacctgatgaccaacccggccatcctcgacggcgacggccacgaagtgccg
gaaggcatcatggacgccgtggtgaccacgctgatcgcgctgcacgaccagcagcgccgc
ggcaactcgcgcgccggctcgatctacatcgtcaagccgaagatgcacggcccggacgaa
gtcgccttcgccgacgagctgttcggcaaggtggaacagctgctcggcctgccgcagtac
accgtcaagctcggcatcatggacgaggaacgccgcaccagcgtcaacctcaaggcctgc
atcgccgccgcccgccatcgcgtggccttcatcaacaccggtttcctcgaccgcaccggc
gacgagatgcacacctcgatggaagccggcccgatgatccgcaagggcgacatgaagacc
tcgaagtggatcgccgcctacgagcgcaacaacgtccaggtcggcctcgactgcggcctg
cgcggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggccgagatg
ctgaagcagaagatcggccacccgaaagccggtgccaacaccgcctgggttccgtccccc
accgccgccgtgctgcacgcgctgcactaccaccaagtcgacgtgcaggaggtgcagaag
gcgctggaagggcagtacgccgacctgcaggacgacctcctgaccatcccggtggcggcc
aatccgaactggtcggccgaagacatccagcaggagctcgacaacaacgcgcagggcatc
ctgggctatgtggtgcgctggatcgaccagggcgtgggctgctccaaggtaccggacatc
cacaacatcggcctgatggaagaccgcgccacgctgcgcatttccagccagcacatcgcc
aactggctgcgccacggcatcgtcaccgaggcgcaggtgaaggaaacgctgcagcgcatg
gccgccgtggtggacggccagaacgcaggcgatccggcctatcagccgatggccccggcg
ttcgacacctcgatcgccttcaaggccgcctgcgacctggtgttccagggctgcgcccag
ccgtccggctacaccgagccgctgctgcaccactggcgccaggtggagaaggcgcacgcg
ctgtaa

DBGET integrated database retrieval system