KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1007Help
Entry
NH8B_1007         CDS       T01619                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00190  Oxidative phosphorylation
pse00650  Butanoate metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pse_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1007
   00650 Butanoate metabolism
    NH8B_1007
  Energy metabolism
   00190 Oxidative phosphorylation
    NH8B_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C DUF2516 pXO2-11
Motif
Other DBs
NCBI-ProteinID: BAK75839
UniProt: G2IZP1
Position
1011233..1011577
Genome map
AA seq 114 aa AA seqDB search
MVNRIVVGAHYGLRDWVLQRVTAVIMAIYTFALVLFLLAMPSSYEGWKAFFGQTWVQVLT
QTTLLAVFMHAWVGIRDLWMDYIKPVGVRLTLHVLTLVWLVSCVIYSIKVVWGL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccgcatcgtcgtcggcgctcattacggtctgcgcgactgggttctgcagcgc
gtcactgccgtgatcatggcgatctacaccttcgcgctggtgttgtttctgttggccatg
ccgtccagctatgaaggctggaaagcattcttcggccagacctgggtgcaggtgctgacc
cagaccaccctgctggctgtgttcatgcacgcctgggttggtatccgtgacctgtggatg
gactacatcaagccggttggcgtgcgtctgacgctgcacgtactcacgctggtatggctg
gtgtcctgtgttatttactcgattaaagtggtatgggggctgtaa

DBGET integrated database retrieval system