KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1015Help
Entry
NH8B_1015         CDS       T01619                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_1015
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1015
   00640 Propanoate metabolism
    NH8B_1015
   00660 C5-Branched dibasic acid metabolism
    NH8B_1015
Enzymes [BR:pse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NH8B_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021864..1023033
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKELLAKYGLPVQQGILAHSPEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAAEVAKTLIGTNLVTYQTDAAGQPVNSVLVCEDMYPVQRELYLGAVVDRGSQ
RVVFMVSTEGGVEIEKVAEETPEKIIKVEVNPLVGMQPFQARDCAFALGLSGKQVGEFTK
LMLGAYEAFVANDFALFEVNPLALRENGELACVDGKINLDSNALYRHPELLAQRDKSQEN
EREVKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKERVI
EAFKLILADTSVKGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
ILDESGLKLTSAQGLNDAAEKIVAAVAAL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcacgaataccaagcgaaagagctgctggccaagtacggcctgccggtgcaa
caaggcattctggctcactcgccggaagaagccgccgctgcttacgacaagctgggtggc
aagtttgccgttgtgaaggcccaggtccacgccggtggccgtggcaaggccggtggcgtg
aaagtggtgaagagccgcgaagaagccgccgaagtcgccaagacgctgatcggcaccaat
ctggtgacctatcagaccgacgcggccggtcagccggtcaacagcgtgctggtgtgcgaa
gacatgtacccggtacagcgcgaactgtacctgggcgccgtggttgaccgcggttcccag
cgcgtggtgttcatggtgtccaccgaaggcggcgtggaaatcgagaaggtcgccgaagaa
accccggaaaagatcatcaaggtcgaagtgaacccgctggtcggcatgcagccgttccag
gcacgcgactgcgcgtttgccctgggcctctccggcaagcaggttggcgaattcaccaag
ctgatgctgggcgcctacgaagccttcgtcgccaacgacttcgcgctgttcgaagtgaac
ccgctggcgctgcgtgaaaacggcgaactggcttgcgtcgacggcaagatcaacctcgac
tccaacgccctgtaccgtcacccggaactgctggcccagcgcgacaagtcgcaggaaaac
gaacgcgaagtgaaggcttccgagttcgacctgaactatgtggcccttgaaggcaacatc
ggctgcatggtgaacggtgccggtctggcgatggccaccatggacatcatcaagctgaag
ggcggccagccggccaacttcctggacgtgggcggtggcgccaccaaggagcgcgtgatc
gaggcgttcaagctgatcctggccgatacctcggtgaagggcgtgctgatcaacatcttc
ggcggtatcgtgcgttgcgacatgattgccgaggcgatcattgctgctgtgaaggaagtg
aacgtgaccgtgccggtcgttgtgcgcctggaaggcaacaacgccgagctgggcgccaag
atcctggacgaatccggtctgaagctgacctccgcccagggcctgaacgacgcagccgag
aagatcgttgctgctgtcgccgccctctaa

DBGET integrated database retrieval system