KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1178Help
Entry
NH8B_1178         CDS       T01619                                 

Definition
oxidoreductase FAD/NAD(P)-binding domain containing protein
Organism
pse  Pseudogulbenkiania sp. NH8B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203238..1204338
Genome map
AA seq 366 aa AA seqDB search
MARIELKDWPIPLENGGETVLETMIAHGVPFPYSCASGDCGACKGRVLCGEVAHDSAPAG
ILSATERADGYVLACRCTPKSDLRIEALDELVALPAARRQRGWVVSRQHRQGDVVVLRVK
PAKPVHYLAGQFFYLKFDNLPQRAYSVASLPGADELEFHVRLVEGGKTSRYVSRDNLVGS
EVTVDGPHGHGYWRQNHDGPIVAIGGGTGLAPVLSIIGAALAANAHRHVHLYYAARVEAD
VYWEAELAALARQYPNLRVDCALSRAEPSEQGPLPRRYQRVTASLEQDWPSLAGAKLYIA
GPPKMVEAVAVTARELGLAARDLHTDPFSDAADHKLDGACTSWLRRFVGRWRRPPFELPG
LATQKG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtatcgaactcaaggactggcccatcccgctggagaacggcggcgaaaccgta
ctggaaaccatgattgcccatggggtgccgtttccctactcctgcgccagcggtgactgc
ggcgcgtgcaagggccgggtgctgtgtggcgaggtcgcgcacgacagcgcccccgccggc
atcctctccgccaccgagcgtgccgacggctacgtactcgcctgccgctgcacgcccaag
agcgacctgcgcatcgaggcgctggacgaactggtcgcgttgcccgcggcgcggcgccag
cgtggctgggtcgtctcccggcaacaccgtcagggcgacgtggtggtgctgcgggtgaag
cctgccaaaccggtgcactaccttgccgggcagttcttctatctgaaattcgacaacctg
ccgcagcgcgcgtactcggttgcctcgctacccggcgccgacgagctggaattccacgtc
cgcttggtggaagggggcaaaacctcccgctacgtgagccgtgacaacctggtcggcagt
gaggtcacggtcgacggcccgcacggccacggctactggcgccagaaccacgacggcccg
attgttgccatcggcggcggtaccgggctggcaccggtgttgtccatcatcggcgccgcg
ctcgccgcgaacgcgcaccgccacgtgcacctgtactacgcggcacgcgtggaagcggat
gtgtactgggaagccgaacttgccgcgctcgcgcgccagtacccaaacctgcgcgtggac
tgtgcgctgtcacgtgccgagccgtcggagcaggggccgttgccgcgccgctaccagcgc
gtgaccgcaagcctcgaacaggactggcccagtcttgccggcgccaagctttacatcgcg
ggcccgccgaagatggtcgaggcggtcgccgtcaccgcgcgcgaactggggctcgccgca
cgggatctgcacaccgacccgttctcggatgccgccgaccacaagctcgacggggcatgc
accagttggctgcgccgctttgtcgggcgctggcgccgcccgccgttcgagctaccaggc
ttggcaacgcagaaggggtga

DBGET integrated database retrieval system