KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1189Help
Entry
NH8B_1189         CDS       T01619                                 

Gene name
cheB
Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NH8B_1189 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NH8B_1189 (cheB)
Enzymes [BR:pse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NH8B_1189 (cheB)
Two-component system [BR:pse02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   NH8B_1189 (cheB)
Bacterial motility proteins [BR:pse02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NH8B_1189 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1215984..1216682
Genome map
AA seq 232 aa AA seqDB search
MGIPPKVVNAKPTTIDVAPSHSADIILARQPGRAPLLRQSVIVIGSSTGGTEALRALLTV
LPEGMPPILVAQHMPEMFTKSFAARLDSLCKLRVKEAEDNERLQANTVYIAPGHSHLLLQ
AIPALGLVASLNAGPPVNRHRPSVDVLFRSAANVAGKNCIGIILTGMGRDGASGMLELKQ
AGAYNIAQDEASCVVFGMPKEAIAQGGTHEVLPLTSIAARLQALVQQRPPQS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggggattccgccgaaagtggtcaacgccaaaccaacaaccattgacgtcgcacccagt
cactcggccgacatcatcctggcgcggcagcctgggcgtgcgcccttgctgcggcagagc
gtcatcgtcatcggctcctcgaccggcggcacggaagccctgcgagcactgctgacggtg
ctgcccgaggggatgccaccgatcctggtagcccagcacatgccggagatgttcaccaaa
tcgttcgccgcccggctcgattccttgtgcaaactgcgcgtgaaggaggccgaggacaac
gagcggctccaggccaataccgtctacatcgcccctggccactctcacctgctgttgcag
gccataccggccctgggtttggtcgccagtctcaacgccggtccaccggtcaaccgccat
cgcccttcggtcgacgtgctgttccgctccgcggccaacgtcgccggcaagaactgcatc
ggcatcatcctcaccggcatggggcgtgacggcgccagtggcatgctcgaactgaagcag
gcgggtgcctacaacatcgctcaggacgaggccagctgcgtggtgttcggcatgcccaag
gaagccatcgcgcagggcggaacgcacgaggtgctgccgctgacctccatcgccgcgcgc
ttgcaggcactggtacagcagcgaccgccgcagtcataa

DBGET integrated database retrieval system