KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1189Help
Entry
NH8B_1189         CDS       T01619                                 

Gene name
cheB
Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pse02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pse02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1215984..1216682
Genome map
AA seq 232 aa AA seqDB search
MGIPPKVVNAKPTTIDVAPSHSADIILARQPGRAPLLRQSVIVIGSSTGGTEALRALLTV
LPEGMPPILVAQHMPEMFTKSFAARLDSLCKLRVKEAEDNERLQANTVYIAPGHSHLLLQ
AIPALGLVASLNAGPPVNRHRPSVDVLFRSAANVAGKNCIGIILTGMGRDGASGMLELKQ
AGAYNIAQDEASCVVFGMPKEAIAQGGTHEVLPLTSIAARLQALVQQRPPQS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggggattccgccgaaagtggtcaacgccaaaccaacaaccattgacgtcgcacccagt
cactcggccgacatcatcctggcgcggcagcctgggcgtgcgcccttgctgcggcagagc
gtcatcgtcatcggctcctcgaccggcggcacggaagccctgcgagcactgctgacggtg
ctgcccgaggggatgccaccgatcctggtagcccagcacatgccggagatgttcaccaaa
tcgttcgccgcccggctcgattccttgtgcaaactgcgcgtgaaggaggccgaggacaac
gagcggctccaggccaataccgtctacatcgcccctggccactctcacctgctgttgcag
gccataccggccctgggtttggtcgccagtctcaacgccggtccaccggtcaaccgccat
cgcccttcggtcgacgtgctgttccgctccgcggccaacgtcgccggcaagaactgcatc
ggcatcatcctcaccggcatggggcgtgacggcgccagtggcatgctcgaactgaagcag
gcgggtgcctacaacatcgctcaggacgaggccagctgcgtggtgttcggcatgcccaag
gaagccatcgcgcagggcggaacgcacgaggtgctgccgctgacctccatcgccgcgcgc
ttgcaggcactggtacagcagcgaccgccgcagtcataa

DBGET integrated database retrieval system