KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1212Help
Entry
NH8B_1212         CDS       T01619                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
Enzymes [BR:pse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NH8B_1212 (dsbC)
Secretion system [BR:pse02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NH8B_1212 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235197..1235931
Genome map
AA seq 244 aa AA seqDB search
MNATLKKLALAALLLSSAACVAKASDPDVAEVKKAFVTRFPDRKVESVSPTPVSGLYEVV
LPGRQIVYVDAGVKHLFVGDLIDAEKRESLTEKRVAELSKVAWKDLPLAAAMKEVRGSGA
RKVAIFSDPDCPFCKKLERETLKDVNNVTIYTFLYPLTQLHPDAMRKSRQIWCSKDRVGS
WTAHMRQGTELSGPDNCDVSVLEQNQALGAKLGINGTPTMVFGNGRMVSGAIPSAEFEKY
LSAQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaccctgaaaaaactggcgctggcagcgctgctgctgtcgtcggccgcctgc
gttgccaaggcctccgatccggacgtggccgaggtgaagaaggctttcgttacccgcttc
ccggatcgcaaggtggaaagtgtcagtccgacgccggtgagcggtctctacgaggtggtg
ttgccgggccgtcagatcgtctacgtcgacgccggcgtcaagcacctcttcgtcggcgat
ttgatcgatgcggaaaagcgcgagagcctgaccgagaagcgcgtggccgaactctccaag
gtggcgtggaaggatttgccgctggcggcggcgatgaaagaagtgcgcggcagcggcgcg
cgcaaggtggcgattttctccgacccggattgtccgttctgcaagaagctggagcgcgaa
acgctgaaggacgtgaacaatgtcaccatttacaccttcctctacccgctgacccagctg
caccccgacgccatgcgcaagtcgcgccagatctggtgcagtaaggaccgtgtcggtagc
tggactgcgcacatgcgtcaggggaccgagttgagcggtccggacaactgcgatgtcagt
gtgctggagcagaaccaggcgctgggggcgaagcttggcatcaatggtacgccaaccatg
gtgttcggcaacggccgcatggtatccggggcgattccctcggccgaattcgagaaatac
ctgagcgcccagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system