KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1358Help
Entry
NH8B_1358         CDS       T01619                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NH8B_1358
Enzymes [BR:pse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NH8B_1358
    3.5.1.-  
     NH8B_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389778..1390539
Genome map
AA seq 253 aa AA seqDB search
MAHHRCPDALPASLFLTLILAPSVRLQMAGASLVVPAAARQRVYNKVRNCCFGMIAMSPS
VITLSHGDALLVVDVQNDFLPGGRLAVGSGDEVVPVLNRYIDVFVAQRLPVYATRDWHPP
DHCSFTPQGGAWPAHCIAGSNGAQFAPRLHLPRSTVVVSKAMHSKRDAYSGFDGTRLEHA
LQRNGVGRLFVGGLATDYCVLNTVRDALKQGFTVCLLVDAIRAVNVDPDDGMRAEGEMCR
LGAHPVVFRDLAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaccaccggtgtcccgacgcgctgccggcatctctttttctcaccctgatcctg
gccccgtcggttcggttgcaaatggccggcgcaagccttgtcgttcctgccgcagccaga
cagcgggtctacaataaagtgagaaattgctgcttcgggatgattgccatgtccccatct
gtcatcacactgtcgcacggtgacgcccttctcgtggtcgacgtgcagaacgacttcctg
cccggcgggcggttggcggtaggtagcggcgacgaggtggtgccggtgctcaaccgctat
atcgatgttttcgtggctcaacgcttgccggtatatgccacccgggattggcatcctccc
gatcactgttcgttcaccccgcagggcggggcctggccggcgcattgcattgccggcagc
aacggggcccagttcgcgccgaggctgcacctgccgcgctcgaccgtcgtcgtttcgaag
gccatgcatagcaagcgggacgcctattccggcttcgacggcacgcggctggaacatgcc
ctgcagcgtaacggggtggggcgtctgttcgtcggcgggctcgccaccgactattgcgtg
ctcaacaccgtgcgtgacgccctcaagcagggcttcacggtgtgcctgctggtggatgcg
atccgtgccgtcaacgtcgatcccgacgacggcatgcgtgccgagggggagatgtgccgg
ctcggcgcgcatccggtggtgtttcgggatctggcggcatga

DBGET integrated database retrieval system