KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1358Help
Entry
NH8B_1358         CDS       T01619                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pse00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389778..1390539
Genome map
AA seq 253 aa AA seqDB search
MAHHRCPDALPASLFLTLILAPSVRLQMAGASLVVPAAARQRVYNKVRNCCFGMIAMSPS
VITLSHGDALLVVDVQNDFLPGGRLAVGSGDEVVPVLNRYIDVFVAQRLPVYATRDWHPP
DHCSFTPQGGAWPAHCIAGSNGAQFAPRLHLPRSTVVVSKAMHSKRDAYSGFDGTRLEHA
LQRNGVGRLFVGGLATDYCVLNTVRDALKQGFTVCLLVDAIRAVNVDPDDGMRAEGEMCR
LGAHPVVFRDLAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaccaccggtgtcccgacgcgctgccggcatctctttttctcaccctgatcctg
gccccgtcggttcggttgcaaatggccggcgcaagccttgtcgttcctgccgcagccaga
cagcgggtctacaataaagtgagaaattgctgcttcgggatgattgccatgtccccatct
gtcatcacactgtcgcacggtgacgcccttctcgtggtcgacgtgcagaacgacttcctg
cccggcgggcggttggcggtaggtagcggcgacgaggtggtgccggtgctcaaccgctat
atcgatgttttcgtggctcaacgcttgccggtatatgccacccgggattggcatcctccc
gatcactgttcgttcaccccgcagggcggggcctggccggcgcattgcattgccggcagc
aacggggcccagttcgcgccgaggctgcacctgccgcgctcgaccgtcgtcgtttcgaag
gccatgcatagcaagcgggacgcctattccggcttcgacggcacgcggctggaacatgcc
ctgcagcgtaacggggtggggcgtctgttcgtcggcgggctcgccaccgactattgcgtg
ctcaacaccgtgcgtgacgccctcaagcagggcttcacggtgtgcctgctggtggatgcg
atccgtgccgtcaacgtcgatcccgacgacggcatgcgtgccgagggggagatgtgccgg
ctcggcgcgcatccggtggtgtttcgggatctggcggcatga

DBGET integrated database retrieval system