KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1501Help
Entry
NH8B_1501         CDS       T01619                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NH8B_1501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_1501
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_1501
Enzymes [BR:pse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NH8B_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562980..1564179
Genome map
AA seq 399 aa AA seqDB search
MDRYDFPDVRGHFGPYGGIYVAETLMAALAELNEEYARAKADPAFWEEFHYELKHYVGRP
SPIYHAKRWSELLGGAQIYLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNVDSTFYILGTAAGPHPYPMLVRDFQTVIGEECKVQMPEMIGRQPDVVVACVGGGS
NAIGLFYPYIGVDGVRMVGVEAGGDGVETGRHAAPLSIGKPGVLHGFKSYLMQDEDGQII
ETHSVSAGLDYPGVGPEHSYLKDIGRAEYTAINDDEALKAFHDLCRYEGIIPALESSHAL
AWAAKTAPTMSKDQVILVNLSGRGDKDINTVASLSGLTL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatcggtatgattttccggatgtccgcggccatttcggtccgtatggtggcatctac
gtcgccgaaacgctgatggcggcattggctgaactcaacgaagaatacgcacgcgccaag
gctgacccggcgttctgggaagagtttcattacgaactgaagcattatgtcggccgccct
tcgccgatctaccatgccaaacgctggtccgaattgctgggcggggcgcagatctatctc
aagcgcgaagacctgaatcacaccggcgcgcataaggtcaacaacaccatcggccaggca
ttgctggcccggcgcatgggcaagaagcgcgtgatcgccgagaccggcgccggccagcac
ggcgtggcgtcggccaccgtggccgcccgttatggcctcgaatgcgtggtgtacatgggg
gcggaagacgtcaagcgccagtcgcccaacgtgtaccgcatgaagctgctgggcgccacc
gtggtgccggtcgaatccggctccaagacgctcaaggatgcgctcaatgaagcgatgcgc
gactgggtgaccaacgtcgattccaccttctacatcctgggcactgccgccggtccgcat
ccctacccgatgctggtgcgcgacttccagaccgtgatcggcgaggaatgcaaggtgcag
atgccggaaatgatcggtcgccagccggacgtggtggtggcgtgtgtcggtggcggttcc
aacgccattggcctgttctatccgtacatcggcgtcgacggcgtgcgcatggttggcgtc
gaggcgggtggtgacggtgtcgagaccggtcgccatgccgcaccgctgtccatcggcaag
ccgggcgtgctgcacggcttcaagagttacctgatgcaggatgaagacggtcagatcatc
gagacgcactcggtgtccgccggcctggactacccgggggtgggcccggaacacagctac
ctcaaggatatcggtcgcgccgaatacaccgcgatcaatgacgatgaggcgctcaaggca
ttccacgacctgtgccgctacgagggtatcatcccggcgctcgagtccagccacgccctg
gcctgggcggccaagaccgcgccgaccatgagcaaggatcaggtcattctggtcaacctg
tccggtcgcggcgacaaggacatcaataccgtggccagcctgtccggcctgaccttgtaa

DBGET integrated database retrieval system