KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1501Help
Entry
NH8B_1501         CDS       T01619                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NH8B_1501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_1501
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_1501
Enzymes [BR:pse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NH8B_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1562980..1564179
Genome map
AA seq 399 aa AA seqDB search
MDRYDFPDVRGHFGPYGGIYVAETLMAALAELNEEYARAKADPAFWEEFHYELKHYVGRP
SPIYHAKRWSELLGGAQIYLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNVDSTFYILGTAAGPHPYPMLVRDFQTVIGEECKVQMPEMIGRQPDVVVACVGGGS
NAIGLFYPYIGVDGVRMVGVEAGGDGVETGRHAAPLSIGKPGVLHGFKSYLMQDEDGQII
ETHSVSAGLDYPGVGPEHSYLKDIGRAEYTAINDDEALKAFHDLCRYEGIIPALESSHAL
AWAAKTAPTMSKDQVILVNLSGRGDKDINTVASLSGLTL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatcggtatgattttccggatgtccgcggccatttcggtccgtatggtggcatctac
gtcgccgaaacgctgatggcggcattggctgaactcaacgaagaatacgcacgcgccaag
gctgacccggcgttctgggaagagtttcattacgaactgaagcattatgtcggccgccct
tcgccgatctaccatgccaaacgctggtccgaattgctgggcggggcgcagatctatctc
aagcgcgaagacctgaatcacaccggcgcgcataaggtcaacaacaccatcggccaggca
ttgctggcccggcgcatgggcaagaagcgcgtgatcgccgagaccggcgccggccagcac
ggcgtggcgtcggccaccgtggccgcccgttatggcctcgaatgcgtggtgtacatgggg
gcggaagacgtcaagcgccagtcgcccaacgtgtaccgcatgaagctgctgggcgccacc
gtggtgccggtcgaatccggctccaagacgctcaaggatgcgctcaatgaagcgatgcgc
gactgggtgaccaacgtcgattccaccttctacatcctgggcactgccgccggtccgcat
ccctacccgatgctggtgcgcgacttccagaccgtgatcggcgaggaatgcaaggtgcag
atgccggaaatgatcggtcgccagccggacgtggtggtggcgtgtgtcggtggcggttcc
aacgccattggcctgttctatccgtacatcggcgtcgacggcgtgcgcatggttggcgtc
gaggcgggtggtgacggtgtcgagaccggtcgccatgccgcaccgctgtccatcggcaag
ccgggcgtgctgcacggcttcaagagttacctgatgcaggatgaagacggtcagatcatc
gagacgcactcggtgtccgccggcctggactacccgggggtgggcccggaacacagctac
ctcaaggatatcggtcgcgccgaatacaccgcgatcaatgacgatgaggcgctcaaggca
ttccacgacctgtgccgctacgagggtatcatcccggcgctcgagtccagccacgccctg
gcctgggcggccaagaccgcgccgaccatgagcaaggatcaggtcattctggtcaacctg
tccggtcgcggcgacaaggacatcaataccgtggccagcctgtccggcctgaccttgtaa

DBGET integrated database retrieval system