KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1502Help
Entry
NH8B_1502         CDS       T01619                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NH8B_1502
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_1502
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_1502
Enzymes [BR:pse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NH8B_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564192..1564980
Genome map
AA seq 262 aa AA seqDB search
MSRIAACFAALAGKKALIPFITAGDPHPDLTVSLMHGLVEGGADIIELGVPFSDPMADGP
VIQRASERALAHKVGLRHVLDMVAEFRKTNSTTPVVLMGYLNPLCAMGYAEFAKRAAAAG
VDGMLTVDCPPEEAEELATALQQESIDPIFLLAPTTPLQRVAEIARHARGYVYYVSLKGV
TGAGNLDIDDVARKIAALRQYIHVPIGVGFGIRDGATARAIAVTADAVVVGSRLVQEIEA
ATPATARERLTPLVAELKAAIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtattgcagcatgttttgccgcactggccggcaagaaggccctgattccgttc
attaccgcgggtgatcctcatccggatctgaccgtgagcctgatgcatggcctggtcgag
ggcggcgccgacatcatcgagctgggggtgccgttttccgatccgatggccgacggtccg
gtgattcaaagagcctccgagcgcgcgctggcacacaaggtcggcctgcgccatgtgctc
gacatggtcgccgagttccgcaagaccaacagcaccacgccggtggtgctgatgggttac
ctgaatccgctgtgtgccatgggctatgctgaatttgccaagcgtgccgccgccgccggg
gtggacggtatgttgacggtcgattgcccgccggaagaggcggaggaactggccacggcg
ctgcaacaggaaagtatcgacccgatcttcctgttggcgccgaccacaccgctccagcgg
gtggccgagatcgctcgtcatgcgcgcggctatgtttactatgtgtcactgaaaggcgtg
accggtgctggaaatctggacattgacgacgtagcgcgtaaaattgccgcccttagacaa
tacattcatgtgcctatcggtgtcggcttcggtattcgcgacggtgcaaccgcgcgtgcc
attgccgtcacggccgatgctgtcgtggtgggaagccgtctggtccaggaaatcgaggcg
gcaacgcccgcgaccgctcgcgagcggttgacgcccctggtcgccgaactgaaggccgcc
attagttag

DBGET integrated database retrieval system