KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1586Help
Entry
NH8B_1586         CDS       T01619                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NH8B_1586
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NH8B_1586
Enzymes [BR:pse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NH8B_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1661736..1662821
Genome map
AA seq 361 aa AA seqDB search
MYSTVSLPRGPVMVDVAGFTLTDAERVRLRHPLVGGVILFRRNFENIEQLKALTAEIRAL
RSPHLLIAVDHEGGRVQRFLDGFTRLPPMRVLGEAWQRDPQEAESLAETVGYVLAAELRA
CGVDLSFTPVLDLDWGRCAVIGNRSFSRDPEVVSALALALQRGLQRGGMATCGKHFPGHG
YVEGDSHHVIPVDERSLDELMADDIKPFVRLSAAGLTSVMPAHVVYPQVDDQPAGFSRIW
LQDILRQQVKFDGVIFSDDLCMEGAAGAGGIAERARAAFVAGCDMALVCNRPDLADELLA
ALADPAIAGLAERLARMEGQGAQAEWEKTLDSADFAAARATVARLAMPPDALKGPAVGEA
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcactgtatccctcccgcgtggccccgtgatggtggacgtggcgggtttcacc
ctgaccgatgccgagcgcgtgcggcttcgccatcctctggtcggcggggtgatcctgttt
cggcgcaatttcgagaacatcgaacagctcaaggcgctgaccgctgagatccgcgcgctg
cgctcccctcatttgctgatcgcggtggatcatgagggggggcgggtgcagcgcttcctc
gacggtttcacgcgcctgccgccgatgcgcgtgctgggcgaggcctggcagcgcgacccg
caagaagccgaaagcctggccgaaaccgtcggttacgtgctggcggcggaactgcgcgcc
tgcggcgtcgacctgtcgttcaccccggtgctggacctcgactgggggcgttgcgccgtg
atcggcaaccgcagcttcagccgcgaccctgaagtggtttccgccttggcgctggcgctg
cagcgcggtctccagcgcggcggcatggccacctgcggcaagcacttcccaggccatggc
tatgtcgagggcgacagccatcacgtcatcccggtcgacgagcgcagcctggacgagctg
atggccgacgacatcaaacccttcgtgcgtctttccgctgccggcctcacctcggtgatg
ccggcgcacgtggtctacccgcaggtggacgaccagccggctggtttctcgcgtatctgg
ctgcaggacatcctgcgccagcaggtgaagttcgacggggtgatcttctccgacgacctg
tgcatggaaggtgcggctggcgccggcggcatcgccgagcgtgcccgcgccgcctttgtc
gcgggctgcgacatggccttggtgtgcaaccgcccggatctggccgacgaactgctggcg
gccttggcagatccggccatcgccggattggcggagcggctggcgcgcatggaaggacag
ggcgcgcaggccgagtgggaaaagactctggatagcgccgatttcgccgccgcccgcgcc
accgtggcgcgactggcgatgccgccggatgcgctgaaggggcccgcggtgggcgaggcc
agctga

DBGET integrated database retrieval system