KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1839Help
Entry
NH8B_1839         CDS       T01619                                 

Gene name
chlD
Definition
cobaltochelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NH8B_1839 (chlD)
Enzymes [BR:pse01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     NH8B_1839 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1923561..1925525)
Genome map
AA seq 654 aa AA seqDB search
MKHHYPFVAIVGQEQLKRALLLCAVDPSMGGVLIRGDKGTAKSTAARGLAEVLPPIARTA
GCGFNCAPDAPLAECPACQDPDTLAEAAPVPFINLPLGATEDRVLGSLDFEKALKHGQQA
FKPGLLAAAHRGLLYIDEINLLADHLVDVLLDVAAMGVNTVQREGLSVSHPARITLLGTM
NQEEGELRPQLLDRFGMMVDVSAPRDAATRAEVVRRRLAFEADPAGFARRCADDTAALRQ
TLHAAQAGLADVAMPDSLFDFISRLCCEFEVASLRADIVMHKAARALAALDGRREVTAED
VRDAAELVLPHRRRKKPFEQSGLDRDKLDELTRQASEPPPPPPASQPPSGQDSADNRGGE
SEPDNAEPSSNNTDDNAQPGSAAEQLFAAASPAGVGRIEVAALHASEASGRRSSSEGTRH
GHTLRAVPSEAPSQLALDATLKSALLRNPNDFSVTRADLHDKVRVGKQANLILLVVDASG
SMAAKRRMEAVKGCVLGLLQDAYQRRDQVAVIAFRGNAAELVLPPTRQIDQAERALSELP
TGGRTPLAHALQLTAETLARHARADNLTPLLVVLSDGRANIALDTRQDPWREALGLAEAL
AAQGTPALVLDTEEGYVRLGRARELATALQGEYLPLDTLSVESLTLTIRQRLGG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccactaccccttcgtcgccatcgtcggccaggagcagctcaagcgcgcgctg
ttgctgtgcgcggtcgaccccagcatgggcggcgtgctgatccgcggcgacaagggcacc
gccaagagcaccgccgcgcgcggcttggccgaggtgctgccgccgatcgcgcgcaccgcc
ggctgcggcttcaactgcgcgccggacgcgccactggccgagtgcccggcctgccaggac
ccggacacgttggccgaagccgcgccggtgcccttcatcaacctgccgctgggcgccacc
gaagaccgcgtgctgggcagcctggacttcgagaaggcgctcaagcacggccagcaggcg
ttcaagccgggcctgctggcggcggcgcatcgcggcctgctctacatcgacgaaatcaac
ctgctcgccgaccacctggtcgacgtgctgctcgacgtcgccgccatgggcgtcaacacc
gtgcagcgcgaaggcctgtcggtgagccacccggcacgcatcacgctgctcggcacgatg
aaccaggaagaaggcgagctgcgtccgcagttactcgaccgcttcggcatgatggtggac
gtgagcgcgccgcgcgacgccgccacccgcgccgaggtggtacgccgccgcctggcgttc
gaggccgatccggccggcttcgcccggcgctgcgccgacgacaccgccgcgctgcgccag
accctgcacgccgcgcaggccgggcttgccgacgtggccatgcccgattcgctgttcgac
ttcatcagccggctgtgctgcgagttcgaggtcgccagcctgcgcgccgacatcgtgatg
cacaaggcggcacgggcgctggctgcgctcgacggccggcgcgaggtgacggcggaagac
gtgcgcgacgccgccgagctggtgctgccgcaccgccgccgcaagaaaccgttcgagcaa
tccggcctggaccgcgacaagctcgacgagctgacgcggcaggcgtccgaaccgccgccc
ccgccgcctgcttcgcagccgccctcgggccaggacagcgcggacaatcgcggcggcgag
tccgaaccggacaatgccgaaccgtcgagcaacaacaccgacgacaatgcccagccgggc
agcgccgccgagcagctgttcgccgccgcctcccccgccggcgtcggccgcatcgaggta
gccgccttgcacgcctccgaggccagcgggcggcgcagcagcagcgaaggcacgcgccac
ggccacaccctgcgcgccgtgccgagcgaggcgccgagccagctcgcgctggacgccacc
ctcaagagcgcgctgctgcgcaacccgaacgatttcagcgtcacccgcgccgacctgcac
gacaaggtgcgcgtcggcaagcaggccaacctgatcctgctggtggtcgacgcctccggc
tcgatggcggccaagcgccgcatggaagcggtcaagggctgcgtgctgggcctgctgcag
gacgcctaccagcgccgcgaccaggtggcggtgatcgccttccgcggcaatgccgccgag
ctggtgctgccgccgacgcgccagatcgaccaggccgaacgcgccctgtccgagctgccc
accggcgggcgcacgccgttggcgcacgccttgcagctcaccgccgagacgctggcgcgg
cacgcccgcgcggacaatctgacgccgctgttggtggtactctccgacggccgcgccaac
atcgcgctcgatacgcgccaggacccgtggcgcgaggcgctggggttggccgaagccctg
gccgcccagggcacgccggcgctggtgctcgacaccgaggaaggctacgtgcgcctgggc
cgtgcgcgcgaactcgccacggcactgcagggcgaatacctgccgctcgacacgctgtcg
gtggaaagcctgacgttgacgatacggcagcggctgggcggctaa

DBGET integrated database retrieval system