KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1839Help
Entry
NH8B_1839         CDS       T01619                                 

Gene name
chlD
Definition
cobaltochelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pse00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1923561..1925525)
Genome map
AA seq 654 aa AA seqDB search
MKHHYPFVAIVGQEQLKRALLLCAVDPSMGGVLIRGDKGTAKSTAARGLAEVLPPIARTA
GCGFNCAPDAPLAECPACQDPDTLAEAAPVPFINLPLGATEDRVLGSLDFEKALKHGQQA
FKPGLLAAAHRGLLYIDEINLLADHLVDVLLDVAAMGVNTVQREGLSVSHPARITLLGTM
NQEEGELRPQLLDRFGMMVDVSAPRDAATRAEVVRRRLAFEADPAGFARRCADDTAALRQ
TLHAAQAGLADVAMPDSLFDFISRLCCEFEVASLRADIVMHKAARALAALDGRREVTAED
VRDAAELVLPHRRRKKPFEQSGLDRDKLDELTRQASEPPPPPPASQPPSGQDSADNRGGE
SEPDNAEPSSNNTDDNAQPGSAAEQLFAAASPAGVGRIEVAALHASEASGRRSSSEGTRH
GHTLRAVPSEAPSQLALDATLKSALLRNPNDFSVTRADLHDKVRVGKQANLILLVVDASG
SMAAKRRMEAVKGCVLGLLQDAYQRRDQVAVIAFRGNAAELVLPPTRQIDQAERALSELP
TGGRTPLAHALQLTAETLARHARADNLTPLLVVLSDGRANIALDTRQDPWREALGLAEAL
AAQGTPALVLDTEEGYVRLGRARELATALQGEYLPLDTLSVESLTLTIRQRLGG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccactaccccttcgtcgccatcgtcggccaggagcagctcaagcgcgcgctg
ttgctgtgcgcggtcgaccccagcatgggcggcgtgctgatccgcggcgacaagggcacc
gccaagagcaccgccgcgcgcggcttggccgaggtgctgccgccgatcgcgcgcaccgcc
ggctgcggcttcaactgcgcgccggacgcgccactggccgagtgcccggcctgccaggac
ccggacacgttggccgaagccgcgccggtgcccttcatcaacctgccgctgggcgccacc
gaagaccgcgtgctgggcagcctggacttcgagaaggcgctcaagcacggccagcaggcg
ttcaagccgggcctgctggcggcggcgcatcgcggcctgctctacatcgacgaaatcaac
ctgctcgccgaccacctggtcgacgtgctgctcgacgtcgccgccatgggcgtcaacacc
gtgcagcgcgaaggcctgtcggtgagccacccggcacgcatcacgctgctcggcacgatg
aaccaggaagaaggcgagctgcgtccgcagttactcgaccgcttcggcatgatggtggac
gtgagcgcgccgcgcgacgccgccacccgcgccgaggtggtacgccgccgcctggcgttc
gaggccgatccggccggcttcgcccggcgctgcgccgacgacaccgccgcgctgcgccag
accctgcacgccgcgcaggccgggcttgccgacgtggccatgcccgattcgctgttcgac
ttcatcagccggctgtgctgcgagttcgaggtcgccagcctgcgcgccgacatcgtgatg
cacaaggcggcacgggcgctggctgcgctcgacggccggcgcgaggtgacggcggaagac
gtgcgcgacgccgccgagctggtgctgccgcaccgccgccgcaagaaaccgttcgagcaa
tccggcctggaccgcgacaagctcgacgagctgacgcggcaggcgtccgaaccgccgccc
ccgccgcctgcttcgcagccgccctcgggccaggacagcgcggacaatcgcggcggcgag
tccgaaccggacaatgccgaaccgtcgagcaacaacaccgacgacaatgcccagccgggc
agcgccgccgagcagctgttcgccgccgcctcccccgccggcgtcggccgcatcgaggta
gccgccttgcacgcctccgaggccagcgggcggcgcagcagcagcgaaggcacgcgccac
ggccacaccctgcgcgccgtgccgagcgaggcgccgagccagctcgcgctggacgccacc
ctcaagagcgcgctgctgcgcaacccgaacgatttcagcgtcacccgcgccgacctgcac
gacaaggtgcgcgtcggcaagcaggccaacctgatcctgctggtggtcgacgcctccggc
tcgatggcggccaagcgccgcatggaagcggtcaagggctgcgtgctgggcctgctgcag
gacgcctaccagcgccgcgaccaggtggcggtgatcgccttccgcggcaatgccgccgag
ctggtgctgccgccgacgcgccagatcgaccaggccgaacgcgccctgtccgagctgccc
accggcgggcgcacgccgttggcgcacgccttgcagctcaccgccgagacgctggcgcgg
cacgcccgcgcggacaatctgacgccgctgttggtggtactctccgacggccgcgccaac
atcgcgctcgatacgcgccaggacccgtggcgcgaggcgctggggttggccgaagccctg
gccgcccagggcacgccggcgctggtgctcgacaccgaggaaggctacgtgcgcctgggc
cgtgcgcgcgaactcgccacggcactgcagggcgaatacctgccgctcgacacgctgtcg
gtggaaagcctgacgttgacgatacggcagcggctgggcggctaa

DBGET integrated database retrieval system