KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1878Help
Entry
NH8B_1878         CDS       T01619                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pse00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pse00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pse02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962601..1964268)
Genome map
AA seq 555 aa AA seqDB search
MATLLDPTSNEQKYSKLTSGVIVGATTANSTRLWVRIYQPGKWSLVVTASPLSGDLVRLE
EKTVPAFLAGNGIAAAYLGEHDFTHDNSLTHVFDIAGLNPDTRYYYAVIASEVDAGKVAR
RTEIGGDAPRHFRTMPEAPSEIVFGFYSCHDHISNNGSAGAWPHYLEQLGDTRAHFSIGG
GDQVYVDTNGKNRFLDIWSWLKDNKKALLDKFALGKGKYDEAGIQQYLLDIYRWYYRVYW
SVPELRSVFEQVPQYMIWDDHEIMDGWGSLTWKERAAQICSFWEEEDSKPNLMLLQLMWK
AACQAYYEYEHSHNPATSYNAADPDQCQWDYAFRHGGAAFYVLDMRGHHDVEKNKGKKIP
DKNILLGQAQFDRFRQWLGSEEVKQANALFIVSPVPVVHWVDRLVNYADLGEAKDDFKDE
WGHETNQWERNQLLETLFKSIDQTGKKVVFLSGDVHCASIFRIRHRKFPAAKVYHATSSA
ISRKPAPKLSLIGISSGGAMENNDNVFTERLYALTGSNNFLMVRARPGANPEIVIELNWA
GGDEGEITKRRIVLD
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggccaccctgcttgatccgacatccaacgaacagaagtacagcaaactcaccagcggc
gtcattgttggggccaccaccgccaacagcacgcggctctgggtccgcatctaccaaccg
ggcaagtggagtctggtcgtcacggcgagcccgctgagcggcgacctggtacggctggaa
gaaaagacggttcccgcatttctggccggcaacgggatcgcggcggcctatctgggcgag
cacgatttcacgcatgacaacagcctgacccacgtcttcgacatcgccggcctcaacccg
gatacccggtactactacgcggtcattgccagcgaagtggatgcgggcaaggtggcgcgc
cgcaccgaaatcggcggcgatgcgccgcgccatttccgcaccatgccggaggccccgtcc
gagatcgtcttcggcttctatagctgccacgaccatatcagcaacaacggtagcgccggg
gcctggccgcactatctcgaacagctgggggacacccgggcccatttctcgatcggcggc
ggcgatcaggtctacgtcgacaccaacggcaagaatcgtttcctggatatctggtcctgg
ctgaaggacaacaagaaagcgctgctcgacaagtttgcccttggcaaaggcaagtacgat
gaggcgggcatccagcaatacctgctcgacatctaccgctggtattaccgcgtctactgg
agcgtgcccgagctgcgctcggtcttcgaacaagttccgcagtacatgatctgggacgac
cacgagatcatggacggctggggctcattgacctggaaggagcgcgcggcgcaaatctgc
tcgttctgggaggaagaagacagcaagcccaacctgatgctgttgcaattgatgtggaaa
gccgcctgccaggcttattacgaatacgagcacagtcacaaccccgctacgtcctacaac
gccgcggaccccgaccaatgccaatgggactatgctttccgccatggcggcgcggccttc
tacgtgctggacatgcgcggccatcacgatgtcgaaaagaacaagggcaagaaaataccc
gacaagaacatcttgctgggtcaggcccagttcgaccgtttccgccagtggctggggagc
gaggaggtgaaacaggccaatgcgctgttcatcgtctcgcctgttccggtggtccattgg
gtcgatcgcctggtcaactacgccgacctcggcgaggccaaggatgatttcaaggacgag
tggggtcacgaaaccaaccaatgggagcgcaaccagctcctggagaccctgttcaagagc
atcgatcagaccggcaagaaagtggtgtttctcagcggggacgtgcactgcgcctcgatc
ttcaggattcgccaccgtaaattccccgccgccaaggtctaccatgccacctcgagcgcc
atctcccgcaagccggctcccaaactgagcctgatcggcatcagttcaggcggcgccatg
gagaataacgacaatgtctttaccgaacgactgtacgccctgacggggtccaacaacttc
ctgatggtgcgggcgcgccccggggccaatccggaaatcgtcatcgaattgaactgggcg
ggcggcgacgaaggcgaaatcaccaaacgccgcatcgtgctcgattaa

DBGET integrated database retrieval system