KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1933Help
Entry
NH8B_1933         CDS       T01619                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_1933
   00030 Pentose phosphate pathway
    NH8B_1933
   00051 Fructose and mannose metabolism
    NH8B_1933
   00052 Galactose metabolism
    NH8B_1933
   00500 Starch and sucrose metabolism
    NH8B_1933
   00520 Amino sugar and nucleotide sugar metabolism
    NH8B_1933
  Nucleotide metabolism
   00230 Purine metabolism
    NH8B_1933
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NH8B_1933
Enzymes [BR:pse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NH8B_1933
    5.4.2.8  phosphomannomutase
     NH8B_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2038354..2039730)
Genome map
AA seq 458 aa AA seqDB search
MSALSKDIFKAYDIRGIVGQTLTDKTAYQIGRAIGSEARARNVKAIVVGRDGRLSGPELC
EALAEGIVTAGIDVIDVGRVATPMVYFAAYELGTLSAVMVTGSHNPPDYNGFKMMLAGDT
LSGPDIQALYQRILDKDFTEGDGQYRTHDIVDAYLDRITSDIKLERPLSIVVDCGNGVPG
AFAPVLYRRLGCRVRQLFCDVDGTFPNHHPDPAKPENLQDVIDALAKTDAEIGLAFDGDG
DRLGVVTKEGNIIWPDRQLMLYAADVLERNPGAKVIYDVKSTRLLGPWIRDNGGEPVMAR
TGHSFIKAKIKETGALLAGEMSGHVFFKERWYGFDDGMYTGARLLEVLSRVEDPNALLNA
LPNAVSTPELNLKMAREGENHALIEKLQQTARFDNAESVITIDGLRVEYADGFGLMRASN
TTPVIVLRFEADNEAALERIQHDFRQILSQATSAPLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgtccaaagacattttcaaggcttacgacatccgcggcatcgtcggccag
accctgaccgacaagactgcctaccagatcggccgcgccatcggctccgaagcccgcgcc
cgcaacgtcaaggccatcgtggtcggccgtgacggccgcctgtccgggccggaactgtgc
gaagcgttggccgaaggcatcgtcaccgccggcatcgacgtcatcgacgtcggccgtgtc
gccaccccgatggtgtattttgccgcctacgagctgggcacgctgtccgccgtcatggtc
accggcagccataacccgccagattacaacggcttcaagatgatgctggccggcgacacc
ctctctggaccggacatccaggcgctgtaccagcgcattctggacaaggatttcaccgaa
ggtgacggccagtaccgtacgcacgacatcgtcgatgcctatctcgaccgcatcaccagc
gacatcaagctggagcgcccgctgagcatcgtggtcgattgcggcaacggcgtcccgggc
gccttcgccccggtgctgtaccgccgcctgggctgccgcgtgcgccagctgttctgcgac
gtcgacggcaccttccccaatcatcaccccgatccggccaagccggaaaacctgcaggac
gtgatcgacgcgctggccaagaccgatgccgaaatcggcctcgccttcgacggtgacggc
gaccgcctgggcgtggtcaccaaggaaggcaatatcatctggcccgaccgccagctgatg
ctgtacgccgccgacgtgctggagcgcaacccgggcgccaaggtcatctacgacgtcaag
tccacccggctgctcggcccgtggattcgcgacaacggcggcgaaccggtcatggcacgc
accggccacagtttcatcaaggccaagatcaaggaaaccggcgcgctgctggcgggcgag
atgagcggccacgtgttcttcaaggagcgctggtacggtttcgacgacggcatgtatacc
ggcgcccgcctgctggaagtgctgtcgcgcgtcgaggaccccaacgcgctgctcaacgcg
ctgccgaatgccgtgtccacgccggagctcaacctgaagatggcgcgcgagggcgagaac
cacgcgctgatcgaaaagctgcagcagaccgcgcgcttcgacaacgccgaatcggtcatc
accatcgacggcctgcgcgtggaatacgccgacggtttcggcctgatgcgcgcctccaac
accacgccagtcatcgtactgcgcttcgaggccgataacgaggcggcgctggaacgcatc
cagcacgacttccgccagatactaagccaggcgacgtcggccccgctgccgttctga

DBGET integrated database retrieval system