KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2201Help
Entry
NH8B_2201         CDS       T01619                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pse00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2301606..2302580
Genome map
AA seq 324 aa AA seqDB search
MQNNGYETGRLNLPFVGHCTFAKSAVCLDWERIDADVAILGAPNDMGTQWRSGARFGPRG
IREASTLFSFGHAGAYDHEDDVMYLTREDVRMVDVGDADIVHTDMASSNANIEFAVRKIL
ESGAMPVVLGGDHSIHAPVIKAYEGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASE
MDHITGMTQLGIRNVSSSNRADYDAARAAGSNILSVRDVRRLGTEGVLAQIPESGAYYIT
IDIDGFDPSIAPGTGTPSHGGFQYYEVLEIIQALAKRSHGGIVGMDLVEVAPAYDPAGLT
SILAAQLLLNSIGFIFHERAQAKR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataacgggtatgaaacgggccgcctgaacttgccgttcgtgggccattgcact
ttcgccaaatcggcggtttgtctcgactgggagcgtatcgacgccgacgtggcgatcctt
ggcgcgcccaacgacatgggcacgcagtggcgctcgggcgcccgcttcggtccgcgcggc
atccgcgaagcatcgacgctgttttcgttcggccacgctggcgcctacgaccacgaagac
gacgtgatgtacctcacccgcgaggacgtgcgcatggtggacgtgggcgatgccgacatc
gtccataccgacatggccagcagcaacgccaacatcgagttcgcggtgcgcaagatcctc
gaatctggcgcgatgccggtggtgctgggcggcgaccactcgatccacgccccggtgatc
aaggcctacgaaggccgcggcccgatccacatcatccatttcgacgcccacctcgacttc
gtcgacgaacgccacggcgtgcgctacggccacggcaacccgctgcgccgcgcctccgag
atggatcacatcacgggcatgacccagctgggcatccgcaacgtgtcgtcgtcgaaccgt
gccgactacgacgcggcgcgcgcggccggctccaacatcctctcggtacgcgacgtgcgt
cgcctcggcaccgagggcgtgctggcgcagatcccggagagcggggcctactacatcacc
atcgacatcgacggcttcgacccgtccatcgcgccgggcaccggcaccccgagccacggc
ggcttccagtactacgaggtgctggaaatcatccaggcgctcgccaagcgcagccatggc
ggcatcgtcggcatggacctggtcgaggtggcgccagcctacgacccggccgggctgacc
tcgatcctggcggcgcaactgctgctgaacagcatcggcttcatcttccacgaacgcgcc
caggccaagcgctaa

DBGET integrated database retrieval system