KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2261Help
Entry
NH8B_2261         CDS       T01619                                 

Gene name
aceF
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pse01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pse00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pse00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pse00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2376751..2377842
Genome map
AA seq 363 aa AA seqDB search
MIEFKLPSLGADMDEGKLLEWKIHPGDTVKRGDIVAIVDTAKAAVDVESWVDGTVRQLLI
DIGDKVPVGTPIALLLAPGETAENAVLPARGAERRRISPAARKRAGELGVDLASLSGSGP
EGAITLQDVEAKAAASAAPAPDRGAEMRRAIAAAMSRSKREIPHYYLADTIPLRPALAWL
ERRNAELPVTERLLPAVLLLKAVALATRRYPEMNGHWIDGAFRAAPAAHLGVAISLRQGG
LIAPALHDVAAKPLAVLMRELADLVQRARAGSLRSSEMADPTLTVTNLGEQGSESVFGVI
YPPQVALVGFGKVMERPWVEQGQCVAMPSVIASLSGDHRASDGHRGALFLAEIRQLLQQP
DAL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcaaactgccctcgctcggcgccgacatggacgaaggcaagctcttggag
tggaaaatccaccccggcgacacggtcaagcgcggtgatatcgtcgccatcgtcgatacc
gccaaggccgccgtcgacgtggaaagctgggtcgacggcaccgtgcggcaactgctgatc
gacatcggcgacaaggtgcccgtcggcaccccgatcgcgctgctgctggccccgggcgaa
acggcagagaacgccgtgctgcccgccaggggcgccgagcgccgccgcatctcgccggcc
gcgcgcaagcgtgccggcgagcttggcgtcgatctcgccagcctcagcggctcgggaccg
gagggggcgatcaccctgcaggatgtcgaggccaaggcggcggccagtgccgccccggcg
cccgatcgcggcgccgagatgcgccgcgccatcgcggcggcgatgagccgctccaagcgc
gagattccgcactactacctggccgacaccatcccgctgcggccggcgctcgcctggctg
gagcggcgcaacgccgaactgcccgtcaccgagcgcctgctgcccgccgtgctgctgctc
aaggcggtggcgctggccacgcgccgctaccccgagatgaacggccactggatcgacggc
gccttccgcgccgcccccgccgcccacctcggcgtggcgatctcgctgcgccagggcgga
ctgatcgccccggccctgcacgacgtcgccgccaagccgctcgcggtgctgatgcgcgaa
ctcgccgacctggtgcagcgcgcccgtgccggttcgctgcgcagctccgagatggctgac
ccgaccctgaccgtgaccaatctgggcgagcagggcagcgagtcggtgttcggcgtgatc
tacccgccgcaagtcgccctggtcggcttcggcaaggtgatggaacggccatgggtggag
cagggccaatgcgtggccatgccgagcgtcatcgccagcctgtccggcgaccatcgtgcc
agcgacggccatcgcggcgcgctgttcctggccgaaatccgccagctgctgcaacagccg
gatgccctctaa

DBGET integrated database retrieval system