KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2360Help
Entry
NH8B_2360         CDS       T01619                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH8B_2360
Enzymes [BR:pse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NH8B_2360
Peptidases [BR:pse01002]
 Cysteine Peptidases
  Family C44
   NH8B_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2478831..2480705)
Genome map
AA seq 624 aa AA seqDB search
MCGIAGFVGKGASEDLSRMLRLLSHRGPDGAGAWCDRGRGVYLGHTRLAIVDLADGHQPM
WTADGRLGVVFNGEIYNHQALRAELERAGHVFTTDHSDTEVLLHGYREWGEALTHKLNGM
WAFALYDQARQRLFCSRDRFGKKPFYYTFQQDTLVFASELTALLTHPHVTATVSTRAIQK
YIGYGYIPAPHTPYEGIFKLPAGCSLSFALQERVVEVGRYWSFVLEPAETRPAGFERQCQ
EELTALLDQAVARRLVADVPVGVFLSGGVDSSAVAALAARRLEPGQLQTFSIGFDEKGFD
ESGYARQMAEHIEAQHHEQILRCEVARALLPEVVRRLDEPTGDSSLLPTYLLCRFARERV
TVALGGDGADELFGGYAPFRALKWAGYYQKAVPKLVHQVIQLLTSHLPVLDGYMSLDFKL
KRAIRGVGYPSRLWNPVWMCPLDEQEFAELFQQPVDLDEVFSEAIDAWERCSQTDPVDRT
LQFFTDIYLQDDILAKTDRASMMNSLELRSPFLDIDVVNLARTIPSDYKIRHGETKYILK
KAMEPFLPRDTLRRPKQGFAAPVAQWLRGRSLFSEKSGLSCLNNDFIDAAFADHARHRKN
HHSFLWSQWVLGMVVPPRADGALM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcgccgggttcgtgggaaagggcgcatccgaggatctgtcgcggatgctc
cgactgttgagtcatcgcgggccggatggggccggggcgtggtgtgaccggggccgaggg
gtgtatctcggccatacgcggcttgctattgtcgacctggccgatggccatcaaccgatg
tggaccgcagacggccgcctgggggtggtgttcaacggggaaatctacaaccatcaggca
ttgcgcgccgaactggagcgggcagggcatgtcttcaccaccgaccattccgataccgag
gtgctgctgcacggctaccgcgagtggggagaggcgctgacgcacaagctcaacggcatg
tgggcgtttgcgctttacgatcaggcccggcagcggctgttttgcagccgtgaccgtttc
ggcaagaagccgttctactatacgtttcagcaggacaccctggtctttgcgtccgaactg
accgccctgctgacgcatccgcatgtcaccgccacggtgtcgacccgggccatccagaaa
tacatcggctatggctacattccggctccgcacacaccctacgaaggcattttcaagctg
ccggcggggtgctcgctctcctttgcgctgcaggaacgggtggtcgaggtggggcgctac
tggtcctttgttctcgagcctgccgaaacgcgccctgccggcttcgaacgccagtgccaa
gaagagctgaccgcgttgctggaccaggccgttgcccggcgcctggtggccgatgtgccg
gtgggcgtgtttctcagcggcggggtcgactcgtcggcggtggccgcgctggcggcccgc
cgtctcgagccgggccagttgcagacgttcagtatcgggttcgacgagaaaggctttgac
gagtcgggctatgcgcgccagatggcggaacacatcgaggcgcagcaccatgagcagatc
ttgcggtgcgaggtcgccagggcgttgttgcccgaggtggtgaggcggctggatgagccg
acgggcgacagctcgctgctgccgacttatttattgtgccgctttgcccgcgagcgggtg
acggtagcgctgggaggcgatggcgccgacgagctgttcggggggtacgcgccgtttcgg
gccctgaagtgggcgggctattaccagaaggccgtgccgaagctggtacaccaggtgatc
caattactgacaagccacctgccggtgctggatggctacatgagcctcgacttcaagctg
aagcgggccatccgtggggtaggctatccctcccggctgtggaatccggtatggatgtgc
ccgctcgacgagcaggaatttgccgagctgttccagcagccggtcgacctcgacgaggtg
ttctccgaggcgatcgacgcctgggagcgctgctcgcaaaccgatccggtcgatcggacc
ctgcagtttttcaccgatatctatctgcaggacgacattctggcgaaaaccgatcgcgcc
agcatgatgaactcactggagctgcgttcgccgtttctggatatcgatgtcgtcaacctg
gcacggaccattccatccgactacaagatccggcacggcgaaaccaagtacatcctgaag
aaagcgatggagcctttcttgccgagggacaccctgcgtcggccgaaacagggcttcgca
gcaccggtcgcccagtggctgaggggcaggagtctgttttccgaaaaatccggcctgtcc
tgcctcaacaacgactttatcgatgcggcctttgccgatcacgcgcgtcatcggaaaaac
catcattcctttctttggagccagtgggtgttgggcatggtggtgccgccgcgtgcggac
ggggcgttgatgtag

DBGET integrated database retrieval system