KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2442Help
Entry
NH8B_2442         CDS       T01619                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00010  Glycolysis / Gluconeogenesis
pse00260  Glycine, serine and threonine metabolism
pse00680  Methane metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
pse01230  Biosynthesis of amino acids
Module
pse_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_2442
  Energy metabolism
   00680 Methane metabolism
    NH8B_2442
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_2442
Enzymes [BR:pse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     NH8B_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK77256
UniProt: G2J5B1
Position
2563704..2564351
Genome map
AA seq 215 aa AA seqDB search
MDHTPLTRFCFVRHGETDWNRERRLQGQIDTPLNTTGQEQAQTLSLALTARALRFDALYC
SDLVRTRQTAAPIGQATGLDVNLDPLLRERHYGRLQGLTYHEAGEVMPDAYRRHRNRDPH
DVPEGGESLYAFHVRIQAFLERAVLEHPGQRLLVVTHGGVLDMVYRIVTGKPLTEPRDFP
IPNAAFNWIIHHQGAWQLEKWADSEHLGGSLDELL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaccacactccgctgacccgcttctgcttcgtgcgccacggcgaaaccgactggaac
cgcgagcgccgcctgcaaggccagatcgataccccgctcaacaccaccggccaggagcag
gcgcaaacattgagcctggccctgacggcccgggcactgcgtttcgacgcgctctactgc
agcgatctggtgcgcacccgccagaccgccgctcccatcggacaggctaccgggctcgac
gtcaacctcgaccccctgctgcgcgagcgtcactacggccgcctgcagggcctcacctat
cacgaggccggcgaggtcatgcccgacgcctaccgccgccatcgcaaccgcgacccgcac
gacgtcccggaagggggcgagagcctgtacgccttccacgtccggattcaggccttcctg
gagcgggcggtgctcgaacaccccggccaacggctgctcgtcgtcactcatggcggcgtg
ctcgacatggtctaccgcatcgtcaccggtaagccgctgaccgaaccgcgcgattttccc
atccccaacgccgccttcaactggatcatccaccatcagggggcctggcagctggagaaa
tgggcggacagcgagcaccttggtggctcgctggacgaattgctgtaa

DBGET integrated database retrieval system