KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2442Help
Entry
NH8B_2442         CDS       T01619                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_2442
   01230 Biosynthesis of amino acids
    NH8B_2442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_2442
  Energy metabolism
   00680 Methane metabolism
    NH8B_2442
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_2442
Enzymes [BR:pse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     NH8B_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2563704..2564351
Genome map
AA seq 215 aa AA seqDB search
MDHTPLTRFCFVRHGETDWNRERRLQGQIDTPLNTTGQEQAQTLSLALTARALRFDALYC
SDLVRTRQTAAPIGQATGLDVNLDPLLRERHYGRLQGLTYHEAGEVMPDAYRRHRNRDPH
DVPEGGESLYAFHVRIQAFLERAVLEHPGQRLLVVTHGGVLDMVYRIVTGKPLTEPRDFP
IPNAAFNWIIHHQGAWQLEKWADSEHLGGSLDELL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaccacactccgctgacccgcttctgcttcgtgcgccacggcgaaaccgactggaac
cgcgagcgccgcctgcaaggccagatcgataccccgctcaacaccaccggccaggagcag
gcgcaaacattgagcctggccctgacggcccgggcactgcgtttcgacgcgctctactgc
agcgatctggtgcgcacccgccagaccgccgctcccatcggacaggctaccgggctcgac
gtcaacctcgaccccctgctgcgcgagcgtcactacggccgcctgcagggcctcacctat
cacgaggccggcgaggtcatgcccgacgcctaccgccgccatcgcaaccgcgacccgcac
gacgtcccggaagggggcgagagcctgtacgccttccacgtccggattcaggccttcctg
gagcgggcggtgctcgaacaccccggccaacggctgctcgtcgtcactcatggcggcgtg
ctcgacatggtctaccgcatcgtcaccggtaagccgctgaccgaaccgcgcgattttccc
atccccaacgccgccttcaactggatcatccaccatcagggggcctggcagctggagaaa
tgggcggacagcgagcaccttggtggctcgctggacgaattgctgtaa

DBGET integrated database retrieval system