KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2442Help
Entry
NH8B_2442         CDS       T01619                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_2442
   01230 Biosynthesis of amino acids
    NH8B_2442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_2442
  Energy metabolism
   00680 Methane metabolism
    NH8B_2442
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_2442
Enzymes [BR:pse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     NH8B_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2563704..2564351
Genome map
AA seq 215 aa AA seqDB search
MDHTPLTRFCFVRHGETDWNRERRLQGQIDTPLNTTGQEQAQTLSLALTARALRFDALYC
SDLVRTRQTAAPIGQATGLDVNLDPLLRERHYGRLQGLTYHEAGEVMPDAYRRHRNRDPH
DVPEGGESLYAFHVRIQAFLERAVLEHPGQRLLVVTHGGVLDMVYRIVTGKPLTEPRDFP
IPNAAFNWIIHHQGAWQLEKWADSEHLGGSLDELL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaccacactccgctgacccgcttctgcttcgtgcgccacggcgaaaccgactggaac
cgcgagcgccgcctgcaaggccagatcgataccccgctcaacaccaccggccaggagcag
gcgcaaacattgagcctggccctgacggcccgggcactgcgtttcgacgcgctctactgc
agcgatctggtgcgcacccgccagaccgccgctcccatcggacaggctaccgggctcgac
gtcaacctcgaccccctgctgcgcgagcgtcactacggccgcctgcagggcctcacctat
cacgaggccggcgaggtcatgcccgacgcctaccgccgccatcgcaaccgcgacccgcac
gacgtcccggaagggggcgagagcctgtacgccttccacgtccggattcaggccttcctg
gagcgggcggtgctcgaacaccccggccaacggctgctcgtcgtcactcatggcggcgtg
ctcgacatggtctaccgcatcgtcaccggtaagccgctgaccgaaccgcgcgattttccc
atccccaacgccgccttcaactggatcatccaccatcagggggcctggcagctggagaaa
tgggcggacagcgagcaccttggtggctcgctggacgaattgctgtaa

DBGET integrated database retrieval system