KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2449Help
Entry
NH8B_2449         CDS       T01619                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NH8B_2449
Enzymes [BR:pse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NH8B_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2571598..2573148)
Genome map
AA seq 516 aa AA seqDB search
MIDQRQKEESKGELTVNAGHKLRLKWLGIDTYQEAVIYMRRDCEVCRSEGFEAQSRVRVA
RNGVEIVATLNVIDSDLLAPHQASLSSAAWRQLDGREGDSIRVRPLPPLESLIALRSKIY
GHRLNDEQMYCIIEDVARGRYPNIYLAAFVAACAGGRLDADETVSLTRAMVNVGQRLDWG
SAPVVDKHCVGGLPGNRTTPIVVAIVTAAGLIMPKTSSRAITSPAGTADTMETLAPVALD
LPAIRRVVGKEGGCIVWGGAVNLSPADDILIRVERPMDLDSEGQLVASVLSKKVAAGSSH
ALIDIPVGYTAKIRSQHAATVLKTLLEYVAGNLGLAIQVVFTDGSQPVGRGVGPALEARD
ILAVLRNEADAPADLRERSLTLAGTLLEFCGTAAIGTGVAHARRLLDSGQAWAKFVAIAN
AQGGLRTPPVAPHTHPVCAVKAGRVTAIDNRLVSRAAKLAGAPRAASAGIDLHVMVDSHV
DIGMPLFTVHAETPGELEYALSYLDMHPQIVVVEER
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcaacggcaaaaagaagaatcaaagggggagctaacggtgaatgccggtcat
aaattgcgcttgaagtggcttggtatcgacacctaccaggaagccgtgatctatatgcgg
cgcgactgcgaggtatgccgctcggaggggttcgaggcgcagtcgcgcgtgcgcgtggcg
cgcaacggcgtggagatcgtcgccacgctgaatgtcatcgattccgacctgctcgctccg
caccaggccagtctgtcctcggcggcttggcgtcagctggacggccgtgaaggggatagc
atccgggtccggcctctgccgccgctggaatcgctgattgccttgcgcagcaagatctac
ggccatcgtctgaacgatgagcagatgtattgcatcatcgaggacgtggcgcgagggcgc
taccccaacatctatctggccgcatttgtcgcggcctgcgccggcggccgcctggatgcc
gacgagaccgtatccttgacgcgcgccatggtgaatgtggggcaacgcctggattggggc
agcgccccggtcgtcgacaaacactgcgtcggcggcttgccgggcaatcgcaccaccccc
atcgtggtggcgatcgtgaccgcggccgggctgatcatgcccaagacctcttcccgtgcc
atcacgtcgccggcgggcacggccgataccatggaaaccctggcacccgtcgccctcgat
ctgccagccatccgccgtgtcgtcgggaaagagggcgggtgcatcgtctggggcggcgcc
gtcaacctgagcccggccgacgatatcctgatccgtgtcgaacgcccgatggacctcgac
agcgaaggccagttggttgcctccgtactgtccaagaaagtggccgccggttccagccat
gcgctgatcgacattcccgtcggctacaccgccaagatacgctcgcagcacgcggcgacc
gtgctgaaaacccttctcgaatacgtggcggggaacctcggattggccattcaggtggtg
ttcaccgacggcagccagccggtcgggcggggtgtggggcccgctttggaggcccgcgac
attctggcggtattgcgcaatgaagcggatgcgccggccgatctgcgcgagcgctcgctg
acgctggcgggcaccctgctcgagttttgcggcaccgccgcgatcggcaccggtgtggcc
catgcccggcgcctgctcgattcgggtcaggcgtgggcgaaattcgtcgccattgccaat
gcccagggcggcttgcgcacgccgcccgtggctccccacactcaccctgtctgcgccgtg
aaggccggccgcgtcaccgccatcgacaatcgcctggtcagccgggccgccaaattggcc
ggtgccccacgcgcggcgtcagccggtatcgacctgcacgtgatggtcgacagccacgtc
gacatcggcatgccgctgttcacggtgcacgccgagacaccgggcgagctcgagtatgcc
ctcagctatctggacatgcaccctcagatcgtggtggtggaggagcgatga

DBGET integrated database retrieval system