KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2628Help
Entry
NH8B_2628         CDS       T01619                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NH8B_2628
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_2628
Enzymes [BR:pse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NH8B_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2754442..2755236
Genome map
AA seq 264 aa AA seqDB search
MSDILKTIIATKHIEVADCLKTRSLADVRADAEARRDDRRDFVAAIRAKHAAGQAAVIAE
AKKASPSKGVIRADFDPAAIARSYADHGAACLSVLTDRQYFQGSAEYLQAARAACALPVL
RKDFMVGEYQIYEARAMAADCILLIAAALSLSEMRAFEALALELGMAVLVEVHDEAELEL
ALQLATPLIGVNNRNLRTFEVSLDNTLKLLPRIGKDRIAVTESGIRSAEDVRLMRDHGVH
SFLVGEAFMREPDPGLALEQLFRG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgaagaccatcatagccaccaagcacatcgaagtggccgattgcctg
aaaacccgttcccttgcggacgtccgcgccgacgccgaagcgcgccgggacgatcgccgc
gactttgtggccgcgattcgcgccaagcatgcggcaggacaggctgccgtcatcgccgaa
gccaaaaaggccagcccgagcaagggcgtgatccgtgccgacttcgaccccgccgccatc
gccagaagctacgccgatcacggcgcggcctgcctgtcggtgctgaccgaccgccaatac
ttccagggcagtgccgagtatctacaggctgcccgtgccgcctgcgcactgccggtgctg
cgcaaggacttcatggtcggcgagtaccagatctacgaagcgcgcgcgatggccgccgac
tgcatcctgctgattgccgcggcgctgtcgctgtccgagatgcgagcctttgaagcgctg
gcactggagctgggcatggcggtactggtggaagtgcacgacgaggccgagctggaactg
gcgctgcaactcgccaccccgctgatcggcgtcaacaaccgcaacctgcgtaccttcgag
gtcagcctcgacaacaccctgaagctgctgccacgcatcggcaaagaccgcatcgcggtg
accgagagcggcatccgtagcgccgaagacgtacgactgatgcgcgaccacggcgtgcat
agcttcctggtcggcgaggccttcatgcgcgagccggacccaggcctggcgctggagcag
ctgttccgcggttga

DBGET integrated database retrieval system