KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2860Help
Entry
NH8B_2860         CDS       T01619                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NH8B_2860 (recR)
DNA repair and recombination proteins [BR:pse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NH8B_2860 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3026170..3026769)
Genome map
AA seq 199 aa AA seqDB search
MKNPPSLDQLISALKVLPGVGPKSAQRMAFHLLQRDQAGADRLARALDRALANLTHCERC
NTFSETPLCNLCAEPARNQHQLCIVEMPADLLMLEQARCYDGLYFVLMGRLSPIDGIGPK
DVNLDKLMVRALDGVVEEVIIATNFTAEGEVTAHMIAELLKDRGLAVSRIARGMPVGGEL
EYVDSGTLAQALYERRQLG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccccttcgctcgaccagttgatctccgcgctcaaggtgctgcccggggtc
ggccccaagtcggcccagcgcatggcgttccacctgctgcagcgcgatcaggctggggcc
gaccggctggcgcgcgcgctcgaccgggcgctggccaacctgacccactgcgagcgctgc
aacaccttcagcgagacgccgttgtgcaatctgtgcgccgagccggcgcgcaaccagcac
cagctgtgcatcgtggaaatgccggccgacctcctgatgctggagcaggcgcgctgctac
gacgggctgtatttcgtgctgatggggcggctgtcgccgatcgacggcatcggccccaag
gacgtcaacctcgacaagctgatggtgcgcgcgctcgacggcgtggtggaggaggtgatc
atcgccaccaacttcaccgccgaaggcgaggtgacggcgcacatgatcgccgagttgctg
aaggaccggggcctggcggtcagccgcatcgcgcgcggcatgccggtgggcggcgagttg
gagtacgttgactcaggcacgctggcgcaggcgctgtacgagcggcgtcagctggggtga

DBGET integrated database retrieval system