KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3011Help
Entry
NH8B_3011         CDS       T01619                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NH8B_3011
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NH8B_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3175874..3176356)
Genome map
AA seq 160 aa AA seqDB search
MSRAYIALGSNLEQPQQQVRAAFAALGTIPGVSLRRASSLYRTAPVGYLDQPDFINAVAE
LDTDLSPLALLDALMALEEHFGRVRSFRNAPRVLDLDLLMMEDVELESERLTLPHPRMHE
RTFVLAPLAELQPDLAVGRHGRADRLLAGLDASGVERLEG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgggcgtacatcgcgctgggcagcaacctggagcagccgcagcaacaggtccgc
gccgccttcgcggcgctgggcaccatccccggagtgagtctgcggcgcgcctcctcgctg
tatcggaccgccccggttggctatctggaccagcccgacttcatcaacgcggtcgccgag
ctggataccgacctttccccgctggccttgctggacgccctgatggcgctcgaagagcac
ttcgggcgggtgcgctcgttccgcaacgctccgcgcgtactcgacctcgacttgctgatg
atggaggatgtcgagctggagtccgagcgtctgaccttgccgcacccgcgcatgcacgag
cgcactttcgtgctggcaccgctggccgagttgcagcccgatctcgccgtcggccggcat
ggccgcgcggaccggctgctggccgggctggatgcatcgggcgtggagcggctggaaggc
taa

DBGET integrated database retrieval system