KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3101Help
Entry
NH8B_3101         CDS       T01619                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NH8B_3101
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NH8B_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3270028..3270927)
Genome map
AA seq 299 aa AA seqDB search
MPKIVVIGSINMDLVVLCPRFPAPGETLLGERFFTCHGGKGANQAVAARRLGAEVSFIGR
VGDDGFGHELVAGLQQEGVDTRHVAVTPGVASGVATITVSGGENAIVVVPGANHALSPDD
VRQAEAEIASADVLLTQLEIPLDAVEEVACLAERHGVPLILNPAPAQALPPELLAKVAYL
TPNQHELAQLLGVEAAGLERLPARLAGKVVLTRGGEGADYIDAAGVLHHQPGRAVPVIDS
TGAGDTFNAALAVFLPLGMAAALERAVAAGALAVTQPGARAGMPTVAQLEAFLAVARQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagatcgtggtgatcggcagcatcaatatggacctggtcgtgctgtgtcctcgt
tttccggcgccgggcgaaacgctgctcggcgagcgtttcttcacctgccatggcggcaag
ggggccaaccaggcggtcgcggcgcgccgcctcggcgccgaggtcagcttcatcgggcgt
gtcggcgacgacggtttcggccatgaactggtggccgggctgcagcaggagggggtggac
acacgtcacgtggcggtgacgcccggcgtcgccagtggcgtcgccaccatcaccgtcagc
ggcggggagaacgccatcgtcgtcgtgcccggtgccaatcatgcgctgagtccggacgat
gtgcgccaggccgaagccgagatcgcttcggccgacgtgctgctgacgcaactggaaatt
cctctggacgccgtggaagaagttgcctgccttgccgagcggcatggcgtgccgctgatc
ctcaacccggcgccggcgcaggccctgccgcccgaactgctggcgaaggtggcctacctt
acgcccaatcagcacgaattggcgcagctgcttggtgtggaggccgccgggctcgagcgc
ctgccggcgcggctggcaggcaaggtggtgctgacgcgaggcggggagggggccgattat
atcgatgcggcgggtgtgcttcaccaccagcccgggcgcgccgtgccggtcatcgacagc
accggggccggcgataccttcaacgccgcgctggcggtgtttctacccttgggtatggcg
gcggcgctggagcgcgccgtcgcggcaggggcgctggcggtgacgcagccgggggcgcgg
gccggcatgccgacggtcgcacagctggaggcgttcctcgccgtggcccggcaacggtga

DBGET integrated database retrieval system