KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3170Help
Entry
NH8B_3170         CDS       T01619                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NH8B_3170
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NH8B_3170
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NH8B_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3345181..3345663
Genome map
AA seq 160 aa AA seqDB search
MSAPLYAFNFTLLDGSPAKLQDYAGKVILVVNTASQCGYTPQYAGLEALYRRYRDRGLVV
IGFPCNQFGRQEPGSDAEIGAFCQKNYGVSFPMASKVDVNGATAHPLWHHLVRAKPGLLG
TRRIKWNFTKFLIDRQGHIVARHSALTKPEALASKIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccactctacgccttcaacttcaccctgctggatggctctccggccaagctt
caggactacgccggcaaggttatcctggtggtgaatactgccagccagtgcggctacacc
ccacaatacgcaggcctggaggcgctgtaccggcgctaccgcgatcgcgggctggtggtc
atcggtttcccctgcaaccagttcggccggcaggagcctggcagcgatgctgaaatcggg
gctttttgccagaagaactacggcgtgagtttccccatggcgagcaaggtggacgtcaac
ggcgccaccgcgcacccattgtggcatcacttggtgcgggccaagccgggcctgctgggc
acacgccgcatcaagtggaatttcaccaagttcctgatcgaccgccagggccacatcgtg
gcgcgccactcggcgctgaccaagccggaagcactggccagcaagatcgaagccttgctc
tga

DBGET integrated database retrieval system