KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3170Help
Entry
NH8B_3170         CDS       T01619                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pse00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pse00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3345181..3345663
Genome map
AA seq 160 aa AA seqDB search
MSAPLYAFNFTLLDGSPAKLQDYAGKVILVVNTASQCGYTPQYAGLEALYRRYRDRGLVV
IGFPCNQFGRQEPGSDAEIGAFCQKNYGVSFPMASKVDVNGATAHPLWHHLVRAKPGLLG
TRRIKWNFTKFLIDRQGHIVARHSALTKPEALASKIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccactctacgccttcaacttcaccctgctggatggctctccggccaagctt
caggactacgccggcaaggttatcctggtggtgaatactgccagccagtgcggctacacc
ccacaatacgcaggcctggaggcgctgtaccggcgctaccgcgatcgcgggctggtggtc
atcggtttcccctgcaaccagttcggccggcaggagcctggcagcgatgctgaaatcggg
gctttttgccagaagaactacggcgtgagtttccccatggcgagcaaggtggacgtcaac
ggcgccaccgcgcacccattgtggcatcacttggtgcgggccaagccgggcctgctgggc
acacgccgcatcaagtggaatttcaccaagttcctgatcgaccgccagggccacatcgtg
gcgcgccactcggcgctgaccaagccggaagcactggccagcaagatcgaagccttgctc
tga

DBGET integrated database retrieval system