KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3380Help
Entry
NH8B_3380         CDS       T01619                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00220  Arginine biosynthesis
pse00250  Alanine, aspartate and glutamate metabolism
pse00290  Valine, leucine and isoleucine biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01130  Biosynthesis of antibiotics
pse01210  2-Oxocarboxylic acid metabolism
pse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH8B_3380
   00290 Valine, leucine and isoleucine biosynthesis
    NH8B_3380
   00220 Arginine biosynthesis
    NH8B_3380
Enzymes [BR:pse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NH8B_3380
    2.6.1.66  valine---pyruvate transaminase
     NH8B_3380
Amino acid related enzymes [BR:pse01007]
 Aminotransferase (transaminase)
  Class I
   NH8B_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAK78138
UniProt: G2IYL7
Position
complement(3553166..3554473)
Genome map
AA seq 435 aa AA seqDB search
MNEHSPRRRKRAKGSGGRNATVNDTAMQPVHKSQKLANVCYDIRGPVLEHAKKMEDEGHR
IIKLNIGNPAPFGFFAPDEIIEDVIANLPDASGYSDSKGLFAARKAIMHYAQQKQLPNVA
MEDIYIGNGASELIVMVMQALLDTGDEVLVPAPDYPLWTAAVSLAGGKAVHYVCDEQAGW
FPDIEDIRAKINANTRAIVVINPNNPTGAVYPPELLAEIVELARQHQLIIYADEIYDKVL
YDEVQHTSIASLAPDVLCVTLNGLSKNYRACGYRAGWMVLSGEKKHARDYIEGLNMLASM
RLCANVPAQFAIQTALGGYQSINDLVATGGRLARQRDLAHELLTAIPGVSCVKPQGALYL
FPRLDPKIYPISDDQQFILELLQEEKVLLVQGSGFNWIAPDHFRVVFLPNSDDLIEAIGR
IARFLENYRKRHGTD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaacactcaccgcgtcgccgcaaacgggccaagggttccggcgggcggaatgcc
acggtaaacgacactgccatgcagcctgtacacaaatcacaaaaactcgccaacgtctgt
tacgacatccgcggaccggtcctcgagcacgccaagaagatggaagacgaaggccaccgc
atcatcaagctcaacatcggcaacccggccccgttcggcttcttcgctccggacgagatc
atcgaggatgtgatcgccaacctgccggacgcctcgggctattccgactccaagggcctg
ttcgccgcgcgcaaggcgatcatgcactacgcccagcagaagcagctgccgaacgtggcg
atggaagacatctacatcggcaacggcgcatccgagctgatcgtgatggtgatgcaggcg
ctgctcgacaccggtgacgaagtgctggtgccggcgcccgactacccgctgtggaccgcc
gcggtcagcctggccggcggcaaggcggtgcattacgtgtgcgacgagcaagccggctgg
ttccccgacatcgaggacatccgcgccaagatcaacgccaacacccgcgccatcgtcgtc
atcaaccccaacaacccgaccggcgcggtctacccgcccgagctgttggccgaaattgtc
gagctggcgcgccagcaccagctgatcatctacgccgacgaaatctacgacaaggtgctg
tacgacgaggtacagcacacctcgatcgccagcctggcgccggacgtgctgtgcgtcacg
ctcaacggcctgtccaagaactaccgcgcctgcggctaccgtgccggctggatggtgctg
tcgggcgagaagaagcacgcccgcgattacatcgaaggcctcaacatgctggcttcgatg
cgcttgtgcgccaacgtgccggcgcagttcgccatccagaccgcgctgggcggctaccag
agcatcaacgacctggtggccacgggcgggcggctggcgcgccagcgcgatctggcgcac
gaactgctgaccgccatccccggcgtcagctgcgtcaagccgcagggggcgctctacctg
ttcccgcgcctcgaccccaagatctacccgatcagcgacgaccagcagttcatcctcgaa
ctgttgcaggaagaaaaggtgctgctggtgcagggctccgggttcaactggatcgccccg
gaccatttccgcgtggtgttcctgcctaacagcgacgacctgatcgaggccatcggccgc
atcgcccgcttcctcgaaaactaccgcaagcgtcacggtaccgactag

DBGET integrated database retrieval system