KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3380Help
Entry
NH8B_3380         CDS       T01619                                 

Definition
class I and II aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NH8B_3380
   01230 Biosynthesis of amino acids
    NH8B_3380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH8B_3380
   00290 Valine, leucine and isoleucine biosynthesis
    NH8B_3380
Enzymes [BR:pse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NH8B_3380
    2.6.1.66  valine---pyruvate transaminase
     NH8B_3380
Amino acid related enzymes [BR:pse01007]
 Aminotransferase (transaminase)
  Class I
   NH8B_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3553166..3554473)
Genome map
AA seq 435 aa AA seqDB search
MNEHSPRRRKRAKGSGGRNATVNDTAMQPVHKSQKLANVCYDIRGPVLEHAKKMEDEGHR
IIKLNIGNPAPFGFFAPDEIIEDVIANLPDASGYSDSKGLFAARKAIMHYAQQKQLPNVA
MEDIYIGNGASELIVMVMQALLDTGDEVLVPAPDYPLWTAAVSLAGGKAVHYVCDEQAGW
FPDIEDIRAKINANTRAIVVINPNNPTGAVYPPELLAEIVELARQHQLIIYADEIYDKVL
YDEVQHTSIASLAPDVLCVTLNGLSKNYRACGYRAGWMVLSGEKKHARDYIEGLNMLASM
RLCANVPAQFAIQTALGGYQSINDLVATGGRLARQRDLAHELLTAIPGVSCVKPQGALYL
FPRLDPKIYPISDDQQFILELLQEEKVLLVQGSGFNWIAPDHFRVVFLPNSDDLIEAIGR
IARFLENYRKRHGTD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaacactcaccgcgtcgccgcaaacgggccaagggttccggcgggcggaatgcc
acggtaaacgacactgccatgcagcctgtacacaaatcacaaaaactcgccaacgtctgt
tacgacatccgcggaccggtcctcgagcacgccaagaagatggaagacgaaggccaccgc
atcatcaagctcaacatcggcaacccggccccgttcggcttcttcgctccggacgagatc
atcgaggatgtgatcgccaacctgccggacgcctcgggctattccgactccaagggcctg
ttcgccgcgcgcaaggcgatcatgcactacgcccagcagaagcagctgccgaacgtggcg
atggaagacatctacatcggcaacggcgcatccgagctgatcgtgatggtgatgcaggcg
ctgctcgacaccggtgacgaagtgctggtgccggcgcccgactacccgctgtggaccgcc
gcggtcagcctggccggcggcaaggcggtgcattacgtgtgcgacgagcaagccggctgg
ttccccgacatcgaggacatccgcgccaagatcaacgccaacacccgcgccatcgtcgtc
atcaaccccaacaacccgaccggcgcggtctacccgcccgagctgttggccgaaattgtc
gagctggcgcgccagcaccagctgatcatctacgccgacgaaatctacgacaaggtgctg
tacgacgaggtacagcacacctcgatcgccagcctggcgccggacgtgctgtgcgtcacg
ctcaacggcctgtccaagaactaccgcgcctgcggctaccgtgccggctggatggtgctg
tcgggcgagaagaagcacgcccgcgattacatcgaaggcctcaacatgctggcttcgatg
cgcttgtgcgccaacgtgccggcgcagttcgccatccagaccgcgctgggcggctaccag
agcatcaacgacctggtggccacgggcgggcggctggcgcgccagcgcgatctggcgcac
gaactgctgaccgccatccccggcgtcagctgcgtcaagccgcagggggcgctctacctg
ttcccgcgcctcgaccccaagatctacccgatcagcgacgaccagcagttcatcctcgaa
ctgttgcaggaagaaaaggtgctgctggtgcagggctccgggttcaactggatcgccccg
gaccatttccgcgtggtgttcctgcctaacagcgacgacctgatcgaggccatcggccgc
atcgcccgcttcctcgaaaactaccgcaagcgtcacggtaccgactag

DBGET integrated database retrieval system