KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3578Help
Entry
NH8B_3578         CDS       T01619                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pse00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3754551..3755393)
Genome map
AA seq 280 aa AA seqDB search
MTAVFHAYPAPAKLNLMLKVVGRRADGYHLLETVFRFIDYSDTVELAVRDDGVIELLNPI
DGVPAERDLTVRAARLLQQHSGTPLGASIRLTKRIPMGGGLGGGSSDAATVLLALNALWQ
TAVPRETLMQLGLKLGADVPVFIFGRNAFATGIGEELTELELPEKWYVVLHPGVHVPTAE
IFSSELLTRDSDISIMRILETTQQRRNDLQRVVTSKYPAVNEALSELEKYGSPLMTGSGS
CVFLECDSEIEADKVYKTLSQKYNGFVAKGLSVHPLFDSI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgtcttccatgcctatccggctccggccaaactcaatctgatgctcaaggtg
gtggggcgccgcgccgacggctaccacctgctggaaaccgtgttccgcttcatcgactac
agcgacaccgtcgagctggccgtgcgcgacgacggcgtgatcgagctgctgaacccgatc
gacggcgtgccggccgagcgcgacctgacggtgcgtgcggcacgcctgctgcaacagcac
agcggcaccccgctcggcgcctcgatccgcctcaccaagcgcattccgatgggcggtggt
ctgggcggcggcagttccgacgccgccaccgtgctgctggcgctcaacgcgctgtggcag
accgctgtgccgcgcgaaaccctgatgcagctgggcctgaagctgggggccgatgtgccg
gtcttcatcttcggccgcaacgcctttgccaccggtatcggcgaggaactgaccgagctg
gagctgccggaaaagtggtacgtggtgttgcatccgggggtgcatgtgccgactgctgaa
attttttcgtcagaactgttgacaagggattccgacatcagcataatgcgaatcctcgaa
acaacgcagcaacgacgaaacgacttgcagcgggttgtaacgagtaagtatccagcggta
aacgaagcgttaagcgagcttgagaaatacggttcgccgctgatgacaggctccggaagt
tgtgtttttctggagtgcgattcggaaatcgaagccgataaagtttataagacgctgtcg
cagaagtacaacggatttgtcgcaaaaggcctttcggtccacccgttgttcgacagtatc
tag

DBGET integrated database retrieval system