KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3879Help
Entry
NH8B_3879         CDS       T01619                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_3879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_3879
   00020 Citrate cycle (TCA cycle)
    NH8B_3879
   00620 Pyruvate metabolism
    NH8B_3879
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NH8B_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4072391..4074010)
Genome map
AA seq 539 aa AA seqDB search
MSNLIELKVPDIGGHDNVDVIELFIQPGATVALDDSLITLETDKATMEVPAAAAGVVKQV
LVKVGDKVSEGSVIALVEAAGAAAVAAPAAAPAPAAAPAPLAAAAPAAAPVATGRVEITV
PDIGGHAGVDVIEVTVKPGDVIAIDDSLITLETDKATMEVPATAAGKVLEVKVKVGDKVS
QGDLIVVVEGAASANVAAAPAAAAAPVAAAPAPAPAPVAAAVAPAASAKIDEAAFSKAHA
GPSARRFARELGVDLGKVQGSGRKGRIVEADIKAYVKGVLSAPPAAAPAAGGSGVGLDLL
PWPKVDFAKFGPIETKPLSRIQKISGANLSRNWVMIPHVTFNDECDITELEDFRKTIGKE
WEKSGLKISPLAFIIKAAAEALKAFPTFNSSLDGDNLVLKQYYHIGFAADTPNGLVVPVI
KNVDQKGIKQIAKELTDLSLLAREGKLKPTDMQGATFTISSLGGIGGTSFTPIVNAPEVA
ILGVCKSQIKPVWNGKDFAPRLMCPLSLSFDHRVIDGAAAARFTVHLGKLLSDVRRLIL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctcatcgaattgaaagtacccgacatcggcggtcacgataacgtcgacgtc
atcgaactgttcatccagcccggcgccaccgtggcgctggacgactcgctgatcacgctg
gaaaccgacaaggccaccatggaagtcccggccgccgccgccggcgtcgtcaagcaggtg
ctggtcaaggtgggcgacaaggtcagcgaaggcagcgtgatcgcgctggtggaagccgcc
ggcgccgctgccgtcgcagccccggccgccgctccggcgccagccgcggctcccgctccg
ttagccgccgccgcacccgccgcggctccggtcgccaccggccgcgtcgagatcaccgtg
ccggacatcggcggccacgccggcgtcgacgtcatcgaggtgacggtgaagccgggcgac
gtgatcgccatcgacgattcgctgatcacgctggaaaccgacaaggccaccatggaagtg
ccggccaccgccgccggcaaggtgctggaggtgaaggtcaaggtgggtgacaaggtcagc
cagggcgacctgatcgtggtggtggaaggcgcggcttcggccaacgtggcggcggctccg
gctgctgctgccgccccggttgccgccgcacccgccccggctccggctccggttgccgcc
gccgtggcaccggccgccagcgccaagatcgacgaggccgccttcagcaaggcgcacgcc
ggtccgtcggcacgccgcttcgcgcgcgaactgggcgtcgacctgggcaaggtccagggc
tccggccgcaagggccgcatcgtcgaggccgacatcaaggcctacgtcaagggcgtgctg
agcgccccgccggccgccgccccggccgctggcggcagcggcgtgggtctcgacctgctg
ccgtggccgaaggtcgatttcgccaagttcggcccgatcgaaaccaagccgctgagccgc
atccagaagatctccggcgccaacctcagccgcaactgggtgatgatcccgcacgtgacg
ttcaacgacgagtgcgacatcaccgagctggaagacttccgcaagaccatcggcaaggaa
tgggaaaagtccggcctgaagatcagcccgctggccttcatcatcaaggccgccgccgag
gcgctgaaggcgttcccgaccttcaacagctcgctcgacggcgacaacctggtgctcaag
cagtactaccacatcggcttcgccgccgacacgccgaacggcctggtggtcccggtgatc
aagaacgtcgatcagaagggcatcaagcagatcgccaaggaactgaccgatctgtcgctg
ctggcacgcgaaggcaagctcaagccgaccgacatgcagggcgccaccttcaccatctcc
agcctgggcggcatcggcggtaccagcttcacgccgatcgtcaacgcgccggaagtggcc
atcctcggcgtctgcaagagccagatcaagccggtgtggaacggcaaggacttcgcgccg
cgcctgatgtgcccgctgagcctgtcgttcgaccaccgcgtgatcgacggcgccgccgcg
gcgcgcttcaccgtgcacctgggcaagctgctgtccgacgtgcgccgtctgatcctctga

DBGET integrated database retrieval system