KEGG   Pseudogulbenkiania sp. NH8B: NH8B_4047Help
Entry
NH8B_4047         CDS       T01619                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
Enzymes [BR:pse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NH8B_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4238639..4239298)
Genome map
AA seq 219 aa AA seqDB search
MDFENARFNLVEQQIRPWDVLDPKVLDLLFHVKREDFVPDDKRTLAFVDTELPLVNGHKM
LQPKVEARLVQDLGLKPEDKVLEIGTGSGHVTALLASLSRHVYSVDLDPVMKEMAAKNLK
KAGISNATLVEGNGIDGYAAQAPFDAILVGGSLPVVPDSLKQQLAVGGRMILVVGDEPVM
TTKLIERESETVFRETNLFEICIPRLAHSEAVEPERFSF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagaatgcccgcttcaacctggtcgaacaacaaattcgtccgtgggatgtg
cttgaccccaaagtactcgatctgctgtttcacgtgaaacgtgaggatttcgtgccggac
gacaagcgcacgctggccttcgtcgacaccgaactgccgctcgtcaacggccacaagatg
ctgcagccgaaggtggaagcccgcctggtgcaggacctcggcctgaagccggaagacaag
gtgctggaaatcggtaccggcagcggtcacgtcaccgccctgctggccagcctgtcgcgc
cacgtctacagcgtcgacctcgacccggtaatgaaggaaatggcggccaagaacctgaag
aaggccggcatcagcaatgccactctggtcgaaggcaacggtatcgacggctacgccgca
caggcgccgttcgacgcgatcctggtcggcggctcgctgccggtggtgccggacagcctg
aagcaacagctggccgtcggcggccgcatgatcctggtggtcggcgacgagccggtgatg
accaccaagctgatcgagcgcgagagcgaaaccgtcttccgcgagaccaacctgttcgaa
atctgcatcccgcgcctggcccactccgaggcggtcgagccggaacggttcagcttctga

DBGET integrated database retrieval system