KEGG   Pseudogulbenkiania sp. NH8B: NH8B_4063Help
Entry
NH8B_4063         CDS       T01619                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pse00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pse00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254157..4255077
Genome map
AA seq 306 aa AA seqDB search
MANPLYRKHIISIPDFTREELELVVETAGRLKAAPRHDLLAGKVVASCFFEPSTRTRLSF
ETSIQRLGGTVIGFADGANTSAKKGETLADTIRIISSYTDAVVMRHPQEGAARLASEFSA
VPVINGGDGANQHPSQTLLDLFTIKESQGRLENLALAFVGDLKYGRTVHSLTQALSLFNC
HFYFVAPEVLAMPDYICEELDERGISYTLAESLEEVIPHVDILYMTRIQRERFDEAEFKQ
IQGQYILKAEMLNHARPNMKVMHPLPRVDEIEVAVDDTPHAYYFEQARNGVFARQALLAL
VLNETV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccctgtaccggaagcacatcatttccatccccgatttcacccgcgaggag
ctcgagctggtggtggaaaccgccggtcgcctcaaggcggcgccgcgacatgacctgctc
gccggcaaggtggtggccagctgcttcttcgaaccctccacccgcacccggctgtcgttc
gagacctcgatccagcgcctgggcggcaccgtgatcggcttcgccgacggcgccaacacc
tcggccaagaaaggcgagacgctggccgacaccatccgcatcatcagctcctacaccgac
gcggtggtgatgcgccatccccaggagggcgcggcgcgcctggccagcgaattctcggcg
gtgccggtgatcaacggcggcgacggcgccaaccagcacccgtcgcagaccctgctcgac
ctgttcaccatcaaggaatcgcagggccggctggaaaacctggcactggccttcgtcggc
gacctcaagtacggccgcaccgtgcactcgctgacgcaggcgctgtcgctgttcaactgc
cacttctacttcgtggcgccggaagtgctggcgatgccggactacatctgcgaggagctg
gacgagcgcggcatctcctacaccctggccgagtcgctggaagaggtgatcccgcacgtc
gacatcctgtacatgacgcgcatccagcgcgaacgcttcgacgaggccgaattcaagcag
atccagggccagtacatcctcaaggccgagatgctgaaccacgcccgccccaacatgaag
gtgatgcacccgctgccgcgcgtcgacgagatcgaggtggcggtggacgacaccccgcac
gcctactacttcgaacaggcgcgtaacggcgtcttcgcgcgccaggcgctgctggcgctg
gtgctgaacgaaaccgtgtga

DBGET integrated database retrieval system