KEGG   Pseudogulbenkiania sp. NH8B: NH8B_4063Help
Entry
NH8B_4063         CDS       T01619                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NH8B_4063
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH8B_4063
Enzymes [BR:pse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NH8B_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254157..4255077
Genome map
AA seq 306 aa AA seqDB search
MANPLYRKHIISIPDFTREELELVVETAGRLKAAPRHDLLAGKVVASCFFEPSTRTRLSF
ETSIQRLGGTVIGFADGANTSAKKGETLADTIRIISSYTDAVVMRHPQEGAARLASEFSA
VPVINGGDGANQHPSQTLLDLFTIKESQGRLENLALAFVGDLKYGRTVHSLTQALSLFNC
HFYFVAPEVLAMPDYICEELDERGISYTLAESLEEVIPHVDILYMTRIQRERFDEAEFKQ
IQGQYILKAEMLNHARPNMKVMHPLPRVDEIEVAVDDTPHAYYFEQARNGVFARQALLAL
VLNETV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccctgtaccggaagcacatcatttccatccccgatttcacccgcgaggag
ctcgagctggtggtggaaaccgccggtcgcctcaaggcggcgccgcgacatgacctgctc
gccggcaaggtggtggccagctgcttcttcgaaccctccacccgcacccggctgtcgttc
gagacctcgatccagcgcctgggcggcaccgtgatcggcttcgccgacggcgccaacacc
tcggccaagaaaggcgagacgctggccgacaccatccgcatcatcagctcctacaccgac
gcggtggtgatgcgccatccccaggagggcgcggcgcgcctggccagcgaattctcggcg
gtgccggtgatcaacggcggcgacggcgccaaccagcacccgtcgcagaccctgctcgac
ctgttcaccatcaaggaatcgcagggccggctggaaaacctggcactggccttcgtcggc
gacctcaagtacggccgcaccgtgcactcgctgacgcaggcgctgtcgctgttcaactgc
cacttctacttcgtggcgccggaagtgctggcgatgccggactacatctgcgaggagctg
gacgagcgcggcatctcctacaccctggccgagtcgctggaagaggtgatcccgcacgtc
gacatcctgtacatgacgcgcatccagcgcgaacgcttcgacgaggccgaattcaagcag
atccagggccagtacatcctcaaggccgagatgctgaaccacgcccgccccaacatgaag
gtgatgcacccgctgccgcgcgtcgacgagatcgaggtggcggtggacgacaccccgcac
gcctactacttcgaacaggcgcgtaacggcgtcttcgcgcgccaggcgctgctggcgctg
gtgctgaacgaaaccgtgtga

DBGET integrated database retrieval system