KEGG   Pseudogulbenkiania sp. NH8B: NH8B_4077Help
Entry
NH8B_4077         CDS       T01619                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_4077
Enzymes [BR:pse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NH8B_4077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4270601..4271455)
Genome map
AA seq 284 aa AA seqDB search
MSLTLPDGASLSELAPGVTLLTLAHDRFDARLSLLGGQLLDYTRHGEPPLLYLSPAAVFQ
PGKAIRGGIPLCWPWFGAHPDDAGAPAHGVARQQPWVLQTVSRDADGFSVRLAGPLHGAL
EASLELRLDDAVELALTTRNHGGAPAPLSAALHSYLALGDIDGATLTGLAGASYLDQLQG
QPSRFGSEPLRFEREIDAIVYPEGPLTLHDAAWGRTVTLSAAGSASSVVWNPWIAKSARL
ADLPDDGYRHFVCVETANAGRDARLLAPGESHTLRTRLQAQPIS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcaccctgcccgacggcgccagcctgagcgagctcgctcccggcgtcaccctg
ctcaccctcgcccacgaccgcttcgacgcccggctctcgctgttgggcggccagctgctc
gactacacccgccacggtgagccgccgctgctgtacctgtcgcccgccgccgtgttccag
cccggcaaggcgatccgcggcggcatcccgctgtgctggccgtggttcggcgcccatccc
gacgacgccggcgcgccggcgcacggcgtggcgcgccagcagccgtgggtgttgcagacg
gtgtcgcgcgacgccgacggcttcagcgtgcggctggccggcccactccacggcgcgctg
gaggccagcctcgagctgcgcctcgacgacgccgtcgagctggcactgaccacccgcaac
cacggcggcgcgccggccccgctctccgccgcgctgcacagctatctggcgctgggcgac
atcgacggcgccaccctcaccggcctcgccggcgccagctacctcgaccagttgcaggga
cagccgtcgcgcttcggcagcgagccgctgcgcttcgagcgcgagatcgacgccatcgtc
taccccgagggcccgctcacgctgcacgacgcggcctggggacgcaccgtcaccctcagc
gccgcgggttccgccagcagcgtggtgtggaacccgtggatcgccaagtcggcccgcctg
gccgacctgccggacgacggctaccgccacttcgtgtgcgtcgagaccgccaacgccggc
cgcgacgcgcgcctcctggcgccgggcgaaagccataccctgcgcacccgcctgcaggcg
cagccgatctcctga

DBGET integrated database retrieval system