KEGG   Pseudomonas sp. CCOS 191: CCOS191_0869Help
Entry
CCOS191_0869      CDS       T03967                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:psec00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCOS191_0869 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CCOS191_0869 (atoB)
   00640 Propanoate metabolism
    CCOS191_0869 (atoB)
   00650 Butanoate metabolism
    CCOS191_0869 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    CCOS191_0869 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CCOS191_0869 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCOS191_0869 (atoB)
   00310 Lysine degradation
    CCOS191_0869 (atoB)
   00380 Tryptophan metabolism
    CCOS191_0869 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCOS191_0869 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCOS191_0869 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCOS191_0869 (atoB)
Enzymes [BR:psec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCOS191_0869 (atoB)
Exosome [BR:psec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCOS191_0869 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(953993..955171)
Genome map
AA seq 392 aa AA seqDB search
MNEVVIVAATRTAIGSFQGALANVSAVELGAAVIRQLLAQTQLDPAQVDEVILGQVLTAG
AGQNPARQAAVKAGLPYEVPALTLNKVCGSGLKALHLAAQAIRCGDAEVVIAGGQESMSL
APYVMPSARTGQRMGHGQLVDSMISDGLWDAFNDYHMGITAENLVDKYGLSREQQDAFAA
ESQRKAVAAIEAGRFKDEITPIHIPQKKGEPLVFDTDEQPRPGTTAESLGKLRAAFKKDG
SVTAGNASSLNDGAAAVLLMSANKAKALGLPVLAKVAAYASAGVDPAIMGIGPVSATQRC
LDKAGWQLADLDLIEANEAFAAQALAVGKQLEWDAAKVNVNGGAIALGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgtcatcgtcgccgccacccgcactgccatcggcagcttccagggggcc
ctggccaacgtgtccgccgtggaactgggcgccgcggtgatccgccagctgctggcccag
acccagctggacccggcccaggtcgacgaagtgattctcggccaggtgctcaccgccggc
gccgggcagaaccccgcccgccaggccgccgtcaaggccggcctgccctacgaagtgccc
gccctgaccctgaacaaggtctgcggctcgggtctgaaggccctgcacctggccgcccag
gccatccgctgcggcgatgccgaggtggtgatcgccggtggccaggagagcatgagcctg
gcgccctatgtgatgccctcggcacgcaccggccagcgcatggggcacggccagctggtc
gacagcatgatcagcgacggcctgtgggacgccttcaacgattaccacatgggcatcacc
gccgagaacctggtggacaagtacggcctgagccgcgagcagcaggacgccttcgccgcc
gagtcccagcgcaaggccgtggccgccatcgaggccggccgcttcaaggacgagatcacc
ccgatccacatcccgcagaaaaaaggcgagccgctggtgttcgacaccgatgaacagcca
cgccccggcaccaccgccgagtctctgggcaaactgcgcgccgcgttcaagaaagacggc
agcgtcaccgccggcaacgcctccagcctcaatgacggcgccgccgcggtgctgctgatg
agcgccaacaaggccaaggccctgggcctgccggtactggccaaggtcgccgcctacgcc
agcgccggcgtggacccggcgatcatgggcatcggcccggtgtcggcaacccagcgctgc
ctggacaaggccggctggcagctcgccgacctggacctgatcgaagccaacgaagccttc
gccgcccaggcgctggcggtgggcaaacagctggaatgggatgcggcgaaggtcaacgtc
aatggcggcgccattgccctgggccacccgatcggcgcgtcgggctgccgggtgctggtg
accctgctgcacgagatgatcaagcgcgatgccaagaaagggctggcgaccctgtgcatc
ggcggcggccagggcgtggcgctggcgatcgagcgttga

DBGET integrated database retrieval system