KEGG   Pseudomonas sp. MRSN12121: TO66_03375Help
Entry
TO66_03375        CDS       T03702                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:psem00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TO66_03375
   00630 Glyoxylate and dicarboxylate metabolism
    TO66_03375
   00640 Propanoate metabolism
    TO66_03375
   00650 Butanoate metabolism
    TO66_03375
  Lipid metabolism
   00071 Fatty acid degradation
    TO66_03375
   00072 Synthesis and degradation of ketone bodies
    TO66_03375
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TO66_03375
   00310 Lysine degradation
    TO66_03375
   00380 Tryptophan metabolism
    TO66_03375
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TO66_03375
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TO66_03375
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TO66_03375
Enzymes [BR:psem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TO66_03375
Exosome [BR:psem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TO66_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
770969..772246
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIIGGNRIPFARSNGPYATASNQAMLTAALEGLIERYRLHGLRLGEVAAGAVL
KHSRDFNLTRECVLGSRLSPTTPAYDVQQACGTGLEAALLVANKIALGQIECGIAGGVDT
TSDAPIGVNEGLRKILLQANRGKTLGDKLKTFLQLRPGHLKPELPRNGEPRTGLSMGQHC
ELMAQTWNIPRAEQDRLALESHQKMAAAYAEGWHDDLMTPFLGLSRDNNLRADLTLEKLA
SLKPVFERSDKGTLTAGNSTPLTDGASLVLLGSEEWAKARGLPVLAYLRDGEAAAVDFVN
GAEGLLMAPAYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCKTRLGLD
APLGAIDRSRLNVKGSSLAAGHPFAATGGRIVANLAKLLEVAGQGRGLISICAAGGQGVT
AIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctgcgtcgtgttgcgattatcggcggcaaccgcatccccttcgcccgttcc
aatgggccttacgccaccgcgagcaaccaggcgatgctcaccgcggccctggagggcctg
atcgagcgctaccgcctgcacggcctgcgcctgggcgaagtggcggccggtgcggtgctc
aagcattcccgggatttcaacctgactcgcgaatgcgtgctcggctcgcgcctgtcgccc
accaccccggcctacgatgtccagcaagcctgcggcaccggcctggaagcggcgctgctg
gtggccaacaagattgccctggggcagatcgaatgcggcatcgccggtggggtcgacacc
acgtcggacgcgccgatcggcgtcaacgaggggctgcgcaagatcctgctgcaagccaat
cgcggcaagaccctgggcgacaagctcaagaccttcctgcaactgcgtcccgggcacctc
aagccggaactgccgcgcaacggcgagccccgcaccggattgtcgatgggccagcactgc
gagctgatggcgcagacctggaacattccccgtgccgaacaggaccggctggcgctggaa
agccaccagaaaatggccgccgcctatgccgagggctggcatgacgacctgatgaccccg
ttcctcggcctgagccgcgacaacaacctgcgtgcggacctgaccctggaaaaactggcc
tccttgaagccggtgttcgagcgcagcgacaagggcaccctgaccgcgggcaactccacg
ccgctgaccgatggcgcgtccctggtgttgctgggcagcgaagagtgggccaaggcgcgc
ggcctgccggtccttgcctatctgcgcgacggcgaggcggcggcggtggatttcgtcaac
ggtgcggagggcctgctgatggcgccggcctatgcggtgccgcgcttgctggcgcgcaac
ggcctgacgctgcaggacttcgactactacgaaatccacgaagcctttgccgcgcaggtg
ttgtgcacgctcaaggcctgggaggacgccgactattgcaagacccgcctggggctggac
gcccccttgggcgccatcgaccgcagccggctgaatgtcaaaggcagttcgctggccgcc
gggcatccgttcgccgccaccggcgggcgcatcgttgccaatctggcgaagctgctggag
gtggcggggcaggggcgtgggctgatctcgatctgcgccgccggcgggcagggcgtgacg
gcgattgtcgagcgttga

DBGET integrated database retrieval system