KEGG   Pseudomonas sp. StFLB209: PSCI_1266Help
Entry
PSCI_1266         CDS       T03623                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pses00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSCI_1266
   00630 Glyoxylate and dicarboxylate metabolism
    PSCI_1266
   00640 Propanoate metabolism
    PSCI_1266
   00650 Butanoate metabolism
    PSCI_1266
  Lipid metabolism
   00071 Fatty acid degradation
    PSCI_1266
   00072 Synthesis and degradation of ketone bodies
    PSCI_1266
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSCI_1266
   00310 Lysine degradation
    PSCI_1266
   00380 Tryptophan metabolism
    PSCI_1266
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSCI_1266
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSCI_1266
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSCI_1266
Enzymes [BR:pses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSCI_1266
Exosome [BR:pses04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSCI_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1389556..1390734
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAIGSFQGALAGIPAPELGALVIRRLLEQTGLDAAQVDEVILGQVLTAG
SGQNPARQASILAGLPHSVPALTLNKVCGSGLKAIHLGAQAIRCGDAEVIIAGGMENMSL
APYVLPAARTGLRMGHAQMVDSMITDGLWDAFNDYHMGITAENLVAKYGISREAQDAFAA
ASQHKAIAAIEAGRFKDEITPVSIPQKKGEPRLFDTDEQPRAETSAESLAKLRPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAAELGLPVLASIKAYANAGVDPAIMGIGPVAATRRC
LDKAGWQLNELDLIEANEAFAAQALSVGQELGWDASKVNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALAIAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtggtcatcgttgcggcgacccgcaccgccatcggcagctttcagggtgcc
ctggccggcattcccgcgccggagctgggcgcgctggtcatccgccggctgctggagcag
accgggctggacgccgcgcaggtcgatgaagtgatcctcggtcaggtgctgaccgccggc
agcggccagaaccccgcacgtcaggcatcgatcctggccggcctgccgcacagcgtaccg
gcgctgaccctgaacaaggtatgtggctcggggctcaaggccattcatctgggcgcccag
gcgatccgttgcggcgatgccgaggtaatcatcgcgggcggcatggagaacatgagcctg
gcgccctacgtgctgccagcggcgcgcaccgggctgcgcatgggccatgcccagatggtc
gacagcatgatcaccgacggtctgtgggacgctttcaacgattaccacatgggcatcact
gccgaaaatctggtggcaaagtacggcatcagccgcgaagcccaggacgcctttgccgcc
gcctcgcagcacaaggcaatcgcagctattgaggccggacgcttcaaggatgaaatcacc
ccggtttcgatcccgcagaaaaagggcgaaccccggctgttcgacaccgacgaacaaccc
cgcgccgagaccagtgccgagtcgctggccaagctgcgcccggcgtttcgcaaggacggc
agcgtcaccgcaggtaacgcctccagcctcaacgacggcgccgctgcggtgctgctgatg
agcgcagccaaggcggcggaactcggcctgccggtgctggccagcatcaaagcctacgcc
aacgccggggtcgatccggcgatcatgggcatcggcccggtggcggcaacccgtcgctgc
ctggacaaggccggctggcaactgaacgagctggacctgatcgaagccaacgaagccttc
gcagcgcaggcgctgtcggtgggtcaggaactgggctgggacgcgagcaaggtcaacgtc
aatggcggcgccatcgctttgggccacccgattggcgcctcaggctgccgggtgctggtg
accttgctgcacgaaatgatccgccgcgatgcgaagaagggcctggcgacactgtgtatt
ggcggcgggcaaggcgtggcactggcgattgcccggtaa

DBGET integrated database retrieval system