KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0058Help
Entry
Pse7367_0058      CDS       T02369                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pse7367_0058
Enzymes [BR:pseu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pse7367_0058
Exosome [BR:pseu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pse7367_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73618..76023)
Genome map
AA seq 801 aa AA seqDB search
MNPTISSDQIDLLIWNLHQDPYYVLGPHQVEQDGKSVWAIRAYLPHAEMVTLVDPVRPGK
EYAMHSVHHPNFFECVIPEPELFRYQFKAHEHGKDRLLYDPYSFGVEVLTEFDRHLFAEG
NHYKIYEKLGAHIMEIDGIKGVYFAVWAPNARNVSVIGEFNYWDGRAHQMRKGDPGVWEI
FIPDLGEGAKYKFEVKNSEGHLYEKTDPHGYQQEIRPKTASIVADLEKYEWQDRNWMDER
RNSDPLVKPISIYEMHIGSWMHGNAEELPADGYPVVHAADMKPGARFLTYRELADKLIPY
VKDLGFTHLELLPVAEHPFDGSWGYQVIGFYAATSRYGTPQDFMYFVDKCHENGIGVIVD
WVPGHFPKDGHGLALFDGTHLYNPADDRIGEHKGWGTYAFNYERNEVKNFLIANALFWFD
KYHIDGIRVDAVASIIYRNYCREPGEWVPNEYGGCEYIAGVEFLKHLHGILYSYYPGILS
IAEESTAWPMVTAPTYMGGLGFNLKWNMGWMHDMLDYFEMDPWFRQFHQTNVTFSLMYAF
NENFVLALSHDEIVHEKSAMPGKMPGDIWQKLANLRCLYGYMFTHPGKKSLFMGMEFAQW
SEWNVWGDLEWWLLQHDKHIGMANLIRDLHRLLKQESALHTIDFSYEGFEWMECNDNKNS
VISFIRKGKDGEFVVVVCNFTPVLHGSYRIGVPEPGFYQELLNSDAADYWGSGAGNYGGK
PTDEIAMHSQRYSIDLCLPPLSTLVLKLDQESIEKNNAKREQERLEEERYHQEQERSKRL
LQEQEEQKQKAQDQLHPPILG
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaactatttcaagcgatcaaatcgatcttctgatctggaatttgcaccaagac
ccctactatgttttgggaccccatcaagttgagcaggatggtaagtcagtttgggcgatc
agagcatatttgccccatgccgaaatggtgacattggttgatccagtacggccggggaaa
gagtatgccatgcattcagtgcatcatcccaacttttttgaatgtgtaatcccagagcca
gaattatttagatatcaattcaaagcccatgaacatggcaaagatcggctgctctatgac
ccctacagctttggcgttgaggttttaacggaattcgatcgccatttgtttgcggaagga
aaccactacaaaatctatgagaaacttggcgcgcacatcatggaaattgatggcattaag
ggggtctactttgcggtctgggctcccaatgctcgcaacgtttcggtgattggcgagttt
aattactgggatggccgcgcccaccagatgcgcaagggcgatcctggcgtgtgggaaatt
tttattcccgatctaggtgagggggctaagtataaatttgaagtcaagaactcggaagga
catctctacgaaaaaactgacccccacggttatcagcaagagattcgtcccaaaaccgcc
tcgatcgtagccgatctagaaaaatatgaatggcaagatcgcaattggatggacgagcgg
cgcaatagcgatccccttgtaaaacccatttcgatctatgaaatgcatattgggtcctgg
atgcatggcaatgcggaagaactacccgctgatggctatcccgtagttcatgcggcggat
atgaaaccaggagctagatttctgacctaccgggaactggccgataaattaattccctat
gtcaaagatttgggttttacccacctggaactattgccagtggccgaacacccctttgat
ggatcgtggggctatcaggtgattggcttctatgcggctacttcgcgctatggcacgccc
caggactttatgtattttgtggataagtgccacgaaaatggcattggcgtgattgtggac
tgggtgccgggacatttccccaaagatgggcatggcttggcgttgtttgacggcacgcat
ttatataatcccgctgacgatcggatcggtgaacacaaaggctggggcacttatgcgttt
aactatgaacggaatgaagtaaagaactttttgatcgccaatgccttgttctggttcgac
aaatatcacattgatggcattcgcgtagatgcggtggcctcgatcatctatcgcaactac
tgccgtgaacctggcgaatgggtgcccaatgaatatggcggctgcgaatatatcgctggt
gtagagttcctcaagcacctgcatggcattttatatagctactatcctggcatcttatcg
atcgccgaagaatcaaccgcctggccaatggtgactgcgcctacctatatgggtggtctg
ggcttcaacctgaaatggaatatgggttggatgcatgacatgctcgattatttcgagatg
gacccctggttccgacagttccatcagactaacgttacctttagtttgatgtatgccttt
aatgagaacttcgtccttgctctttcccacgatgagattgtccatgaaaaaagcgcgatg
ccgggtaaaatgcccggtgatatctggcaaaaactagctaatttgcgctgtctctatggt
tatatgttcactcaccccggtaagaagagcctgtttatggggatggaatttgcccaatgg
agtgagtggaatgtgtggggcgatctggaatggtggctgctccagcatgacaagcacatt
ggcatggctaatctaatccgcgatctacatcgtttactcaagcaagaaagcgctctgcat
acgatcgacttttcctatgaagggttcgagtggatggaatgtaatgacaacaagaactcg
gtgatttcctttattcgtaagggcaaagatggcgagtttgtggtggtggtgtgtaatttc
acgccggtgctccatggcagctatcggatcggtgtgcctgaacctggtttttatcaagag
ttgctcaacagtgatgccgctgattattggggtagcggcgctggtaattatggtggtaaa
cctaccgatgaaattgccatgcacagccaaaggtattccattgatctatgtttgccacct
ttgtccacgctggtgttgaagctggatcaagaatcgatcgaaaagaacaatgccaaaaga
gaacaagaacgcttagaagaagaacgctaccaccaggaacaggagcgatcgaagcgattg
ttgcaggaacaagaggaacaaaaacagaaagcacaagatcaactacatccgccaattctg
ggttaa

DBGET integrated database retrieval system